SecReT6
Protein ID: 442321728
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04775
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6122848..6123531 [-]
Producthypothetical protein
NoteTssL
UniProt IDL7UDY6
KEGG IDmsd:MYSTI_04775
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.90E-40, Aligned region: 5..206
Protein Sequence: 227 a.a.     [Download]
>gi|442321728|ref|YP_007361749.1| hypothetical protein MYSTI_04775 [Myxococcus stipitatus DSM 14675]
MDRINSITQESFGALLQLRQFGDNALPAAELVHRQLRTFFDRMLKRANELGFGQQDAQEIAYPIVALADE
LALARADSFREYWLANLLQFHYFRENRAGDGFFTRLEEVRKDLQRTEILRVYYLCLLFGFKGRFRVRGGE
LELMQLTEALQRELSKTYKFDTELLSPRGERPPDSAVSAKRTLPLLAISGAAVVFALLVYTGLRIGLSSS
VSSLIEEVTTSSTQQQP
 
Nucleotide Sequence: 684 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6123531-6122848 Myxococcus stipitatus DSM 14675, complete genome
ATGGACAGAATCAATTCCATCACGCAGGAGAGCTTCGGGGCGTTGCTCCAGCTCCGGCAGTTCGGGGACA
ATGCGCTGCCCGCGGCGGAGCTCGTGCACCGCCAGCTGCGCACGTTCTTCGACCGCATGCTCAAGCGCGC
CAACGAGCTGGGCTTCGGCCAGCAGGACGCGCAGGAGATTGCCTACCCCATCGTCGCGCTCGCGGATGAG
CTGGCCCTGGCTCGCGCGGACTCGTTTCGAGAGTACTGGCTCGCCAACCTCCTCCAGTTCCACTACTTCC
GGGAGAACCGCGCGGGCGACGGCTTCTTCACGCGCCTGGAAGAGGTTCGCAAGGACCTGCAGCGCACGGA
GATCCTCCGCGTCTACTACCTCTGCCTCCTCTTCGGCTTCAAAGGCCGCTTCCGGGTGCGCGGTGGAGAG
CTGGAGCTGATGCAGCTCACGGAGGCGCTCCAGCGCGAGCTGTCCAAGACGTACAAGTTCGACACGGAGC
TGCTCTCGCCTCGGGGCGAGCGGCCTCCGGACAGCGCGGTGAGCGCCAAGCGGACGTTGCCGCTGCTGGC
CATCTCCGGCGCGGCGGTGGTCTTCGCGCTGTTGGTCTACACGGGCCTGCGCATTGGCCTGTCCAGCAGC
GTCTCCTCCCTCATCGAGGAGGTCACCACCTCCTCCACGCAGCAGCAGCCTTAG