SecReT6
Protein ID: 442321729
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04776
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6123624..6125039 [-]
Producthypothetical protein
NoteTssK
UniProt IDL7UAY3
KEGG IDmsd:MYSTI_04776
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-113, Aligned region: 19..450
Protein Sequence: 471 a.a.     [Download]
>gi|442321729|ref|YP_007361750.1| hypothetical protein MYSTI_04776 [Myxococcus stipitatus DSM 14675]
MKTPQRVVWSEGMFMNPQHLQQADLYHEGLLAARLGALTPYDWGVVEQEVDEKALAAGQFQLLRFVGILP
DGLPLSFERGQPEAPQTRPIEEHFSANKRSLDVFLGVAREREGISSYGATEESTTSPRFSLVNRSVPDLA
AAESVVPVSFAQRNLKLLFGTEPREDYDVIKIAELVRDRTGAAALASNYIPPCLRISASPYVLDRLRQIL
KAMQGKQRELAEGRRHRDATAMEFSAGDVTKYLQLSALNGLIPQVAHVVEVADLNPQMVYLLLCQAAGQL
STFSAEADPGDLPKFQYNNLRATFDGLFQLLQKLLDVVAIEQCITVQLESRKDGMHLGRLEDERFLKAAQ
FILAVRSDLPEAEVAKSLPNLSKIASFVEIRDIIKAAAPGVPVEVTFRPPAEVPVKPGVVYFSLESGDPY
WKNVITEQNVAIYLPRPFEPSKTKLELLAVPRQGSNGNGGGSSAKKSAVSR
 
Nucleotide Sequence: 1416 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6125039-6123624 Myxococcus stipitatus DSM 14675, complete genome
ATGAAGACGCCCCAACGTGTTGTCTGGTCCGAGGGGATGTTCATGAATCCCCAGCACCTGCAGCAGGCGG
ACCTCTACCACGAGGGGTTGCTCGCGGCCCGGCTCGGCGCCCTGACGCCGTATGACTGGGGCGTGGTGGA
GCAGGAGGTGGATGAGAAGGCGCTCGCGGCCGGCCAGTTCCAGCTCCTGCGCTTCGTGGGCATCCTGCCG
GACGGGCTGCCACTGTCCTTCGAGCGCGGCCAGCCCGAGGCCCCGCAGACGCGGCCCATCGAGGAGCACT
TCAGCGCGAACAAGCGCTCGCTGGACGTGTTCCTGGGCGTGGCGCGTGAGCGGGAGGGCATCTCCAGCTA
CGGCGCGACCGAGGAGTCCACGACGTCGCCGCGCTTCTCCCTGGTGAACCGCTCCGTGCCGGACCTGGCG
GCGGCGGAGTCCGTGGTGCCGGTGTCCTTCGCGCAGCGCAACCTCAAGCTGCTCTTCGGCACGGAGCCGC
GCGAGGACTACGACGTCATCAAGATCGCCGAGCTGGTGCGGGACAGGACGGGCGCCGCGGCGCTCGCCAG
CAACTACATCCCGCCGTGCCTGCGCATCTCCGCGTCGCCGTACGTGTTGGACCGGCTGCGGCAGATCCTC
AAGGCGATGCAGGGCAAGCAGCGCGAGCTGGCGGAGGGCCGCCGTCACCGCGACGCCACGGCGATGGAGT
TCTCGGCCGGGGATGTGACCAAGTACCTCCAGCTCAGCGCGCTCAACGGCCTCATCCCGCAGGTGGCCCA
CGTGGTGGAGGTCGCGGACCTCAACCCGCAGATGGTCTACCTGCTGCTGTGCCAGGCCGCCGGACAGCTC
TCCACGTTCTCCGCGGAGGCGGACCCGGGAGACCTGCCCAAGTTCCAGTACAACAACCTGCGCGCCACCT
TCGACGGCCTCTTCCAGCTGCTCCAGAAGCTGCTGGACGTCGTGGCCATCGAGCAGTGCATCACCGTGCA
GCTGGAGTCCCGCAAGGACGGCATGCACCTGGGCCGGCTCGAGGACGAGCGCTTCCTCAAGGCCGCGCAG
TTCATCCTCGCGGTGCGCAGCGACCTGCCGGAGGCGGAGGTCGCCAAGAGCCTGCCGAACCTCTCGAAGA
TCGCCAGCTTCGTGGAGATTCGCGACATCATCAAAGCCGCCGCGCCGGGCGTGCCGGTGGAGGTGACGTT
CCGCCCTCCCGCCGAGGTGCCGGTGAAGCCGGGCGTCGTGTACTTCTCGCTCGAGAGCGGCGACCCCTAC
TGGAAGAACGTCATCACCGAGCAGAACGTGGCCATCTACCTGCCGCGTCCGTTCGAGCCGTCGAAGACGA
AGCTGGAGCTGCTCGCGGTTCCCCGGCAGGGCAGCAACGGGAACGGTGGCGGGAGTTCGGCGAAGAAGAG
CGCTGTCAGTCGTTAG