SecReT6
Protein ID: 442321730
SecReT6 ID725
T6SS typei1
Gene symbol-
Locus tagMYSTI_04777
StrainMyxococcus stipitatus DSM 14675
Repliconchromosome [GenBank: NC_020126] [Browse all T6SS(s) in this replicon]
Location [Strand]6125036..6125605 [-]
Producthypothetical protein
NoteTssJ
UniProt IDL7UEN1
KEGG IDmsd:MYSTI_04777
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.00E-31, Aligned region: 28..157
Protein Sequence: 189 a.a.     [Download]
>gi|442321730|ref|YP_007361751.1| hypothetical protein MYSTI_04777 [Myxococcus stipitatus DSM 14675]
MPVCGGGFGPRARSCVWSCLGTVLLSSLVVGACAHTPPAPTTCEQPPPFVLHLDASTRLNADDVGRSLPT
NVQVFQLKGSRRMEAADFQDLWQRPKEVLEEDLLAMDEFTLEPGQQLTREVSRTSGASYLAVVGVFRRPA
GQVWRAVERLPQVKPEDCDPAKKTAARDASMRFLIEDYRVEARSSEARR
 
Nucleotide Sequence: 570 bp     [Download]
>gi|442317022|ref|NC_020126.1|:c6125605-6125036 Myxococcus stipitatus DSM 14675, complete genome
ATGCCGGTTTGTGGGGGGGGCTTCGGCCCACGGGCGCGGAGTTGCGTCTGGTCTTGTCTGGGTACGGTCC
TGCTCTCGAGTCTGGTCGTTGGGGCGTGCGCGCACACCCCTCCCGCGCCGACGACTTGCGAGCAGCCTCC
TCCTTTTGTCCTGCATCTCGACGCGAGCACGCGCCTCAACGCGGATGACGTGGGCCGCTCGCTCCCGACG
AACGTCCAGGTCTTCCAGCTCAAAGGCTCTCGCCGCATGGAGGCCGCCGACTTCCAGGACCTCTGGCAGC
GTCCCAAGGAGGTGCTGGAGGAGGACTTGCTGGCCATGGATGAGTTCACCCTCGAGCCAGGCCAGCAATT
GACGCGTGAAGTCAGTCGGACTTCAGGTGCGAGCTACCTTGCCGTGGTGGGGGTGTTCAGGCGCCCCGCC
GGACAGGTGTGGCGGGCCGTGGAGCGGCTGCCCCAGGTGAAGCCAGAGGACTGCGATCCCGCGAAGAAGA
CCGCCGCGCGTGACGCGTCGATGCGCTTCCTCATCGAGGACTACCGTGTCGAGGCCCGCTCGAGCGAGGC
TCGCAGATGA