SecReT6
Protein ID: 444350929
SecReT6 ID726
T6SS typeN/A
Gene symbol-
Locus tagST548_p7525
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]777219..778526 [+]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDL8BEQ8
KEGG IDear:ST548_p7525
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.90E-133, Aligned region: 6..432
Protein Sequence: 435 a.a.     [Download]
>gi|444350929|ref|YP_007387073.1| Uncharacterized protein ImpJ/VasE [Enterobacter aerogenes EA1509E]
MISPQHFQQQVNQAAWQSECIARLGVMNPWGIIRVEFDAALLKQGKLKASHLYIRFPDGTLIDSDNADAL
PEVMVLPQAESRELTVVLALPHEHENGGNCLQMEQRAERPVRWRLAWREVRNRYGEDSRQIAVMLAQLTL
RTADDNNGDYQTVAVARLRRDSQDCWSLDEDFIPPLLKVLASRWLHEQTEQLTNQLGVRLQRLMAMRRES
NARMADFAVADVSLFWLLNALNSAEPVLNHFLRHPQVHPERLYEALASLAGSLLTFSLDHTTADIPPYRH
QALTEVFPPLFKLLGVLLEASLPSRVVAIEMTHDDRRKRWHARLHDPRLREEADFYLSVRSALPAAQLLE
QLPQQCKAGSPDEVDRVVNGSQPGIPLKAMSHVPAAIPLRLENQYFTLDMTHPAAQAMLAEGSCVFYVPG
LLGDPELELYAVLRS
 
Nucleotide Sequence: 1308 bp     [Download]
>gi|444350194|ref|NC_020181.1|:777219-778526 Enterobacter aerogenes EA1509E, complete genome
ATGATCTCCCCACAACATTTTCAACAACAGGTGAATCAGGCGGCCTGGCAAAGCGAATGTATCGCCCGTC
TGGGCGTGATGAATCCCTGGGGGATTATCCGCGTCGAATTTGACGCCGCATTGCTAAAACAGGGGAAGCT
GAAGGCCAGCCACCTCTATATACGCTTTCCTGATGGAACGCTTATCGACAGCGATAATGCTGATGCGCTG
CCTGAGGTCATGGTGTTGCCGCAAGCGGAAAGCCGCGAATTAACGGTGGTGCTGGCGCTGCCTCATGAGC
ATGAAAACGGCGGCAACTGCCTGCAGATGGAACAACGCGCAGAGCGGCCGGTACGTTGGCGTTTGGCCTG
GCGAGAAGTACGCAACAGATACGGCGAAGACAGTCGACAAATTGCGGTGATGCTTGCGCAACTGACGCTG
CGCACAGCGGATGACAATAACGGCGATTATCAAACCGTCGCCGTCGCCAGATTACGTCGCGACAGTCAGG
ATTGCTGGTCGTTGGATGAGGACTTTATCCCGCCGCTGCTGAAAGTGTTGGCCAGCCGCTGGCTGCACGA
ACAAACGGAACAGCTGACGAATCAACTGGGTGTGCGCCTGCAACGCCTGATGGCCATGCGTAGGGAAAGC
AACGCCAGGATGGCGGATTTTGCGGTAGCGGATGTATCGCTGTTTTGGCTGCTGAACGCGCTTAACAGCG
CGGAGCCGGTGTTGAACCATTTCCTGCGCCATCCGCAGGTACATCCGGAACGGCTGTATGAAGCGCTGGC
CAGCCTGGCGGGCAGCCTGTTGACCTTCTCCCTTGACCATACCACGGCGGATATTCCGCCCTATCGCCAT
CAGGCGTTGACGGAAGTCTTTCCACCGCTGTTCAAATTACTCGGCGTACTGCTCGAAGCCAGCCTGCCAT
CCCGGGTTGTGGCGATTGAAATGACGCACGATGACCGGCGTAAGCGCTGGCATGCCCGTCTGCACGATCC
AAGGTTGCGCGAAGAGGCCGATTTTTATCTCTCGGTGCGTTCCGCGCTACCTGCGGCGCAACTGCTGGAG
CAGTTACCGCAACAGTGTAAAGCCGGTAGCCCCGATGAGGTTGACCGGGTGGTCAACGGTTCGCAGCCCG
GCATTCCGCTGAAAGCCATGAGTCATGTTCCCGCCGCCATCCCGCTGCGCCTGGAGAATCAGTATTTCAC
CCTTGATATGACTCATCCGGCTGCGCAGGCGATGCTGGCGGAAGGGAGTTGCGTCTTTTACGTGCCCGGC
CTGCTGGGCGACCCTGAACTCGAACTCTATGCGGTGCTGCGCTCATGA