SecReT6
Protein ID: 444350930
SecReT6 ID726
T6SS typeN/A
Gene symbol-
Locus tagST548_p7524
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]778523..779188 [+]
Producthypothetical protein
NoteTssL
UniProt IDL8BBZ5
KEGG IDear:ST548_p7524
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-39, Aligned region: 7..208
Protein Sequence: 221 a.a.     [Download]
>gi|444350930|ref|YP_007387074.1| putative membrane protein [Enterobacter aerogenes EA1509E]
MTQDINIDALLADSWLTVTELRLGAKLAEGEGKHLWQRCVDNIEQVMAQLVTADISEANRQHILYAWCAL
LDETAKGRNEEDDACIAWYDRPLEVKYFGGMEAGDALYERIRQVLREPAPDNLVLTCFHRVLALGFKGRY
GLNDPARAALVSALGERVPPFAGDPQQPILANLSGRRGLADWLRRWPVSIGVSLVLVAALWLGLNYWLDA
LVAALRLGGGQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|444350194|ref|NC_020181.1|:778523-779188 Enterobacter aerogenes EA1509E, complete genome
ATGACCCAGGATATCAATATTGATGCTCTGCTGGCGGATAGCTGGCTAACGGTGACGGAACTGCGCCTTG
GCGCCAAACTGGCCGAGGGGGAGGGGAAACATCTCTGGCAGCGTTGTGTAGACAACATTGAACAGGTGAT
GGCGCAGCTGGTGACCGCTGATATCAGCGAGGCGAACCGTCAGCATATCCTCTATGCGTGGTGTGCGCTG
CTGGATGAAACCGCGAAAGGGCGCAATGAGGAAGATGACGCCTGTATCGCCTGGTACGATCGGCCGCTTG
AGGTTAAATATTTTGGCGGCATGGAAGCCGGAGATGCGCTCTATGAGCGCATCCGCCAGGTGCTGCGCGA
GCCGGCGCCGGATAATCTCGTTTTGACTTGTTTCCATCGGGTGCTGGCGCTGGGGTTTAAGGGGCGGTAT
GGCCTCAATGATCCGGCGCGCGCAGCGCTCGTCAGCGCGCTTGGCGAGCGTGTACCGCCGTTTGCGGGCG
ATCCTCAGCAGCCGATTCTGGCGAATCTATCCGGCCGCCGCGGTCTGGCAGACTGGTTGCGTCGTTGGCC
GGTCAGTATTGGCGTGTCGCTGGTGCTGGTGGCCGCGTTATGGTTGGGGTTGAACTACTGGCTGGATGCC
CTGGTGGCGGCGTTGCGACTGGGAGGCGGACAATGA