SecReT6
Protein ID: 444350933
SecReT6 ID726
T6SS typeN/A
Gene symbol-
Locus tagST548_p7521
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]781068..783446 [+]
ProductVgrG protein
NoteTssI
UniProt IDL8BFH9
KEGG IDear:ST548_p7521
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.10E-62, Aligned region: 33..350
DUF2345 [PF10106], Evalue: 5.80E-38, Aligned region: 613..759
T6SS_Vgr [PF13296], Evalue: 7.00E-32, Aligned region: 489..594
T6SS_Vgr [PF13296], Evalue: 7.00E-32, Aligned region: 629..662
Phage_base_V [PF04717], Evalue: 4.50E-17, Aligned region: 388..482
Sarcoglycan_1 [PF04790], Evalue: 0.0037, Aligned region: 622..657
Sarcoglycan_1 [PF04790], Evalue: 0.0037, Aligned region: 681..724
Protein Sequence: 792 a.a.     [Download]
>gi|444350933|ref|YP_007387077.1| VgrG protein [Enterobacter aerogenes EA1509E]
MSDIKPLLFNHSHHLLQVHGCNSLLDVLCFEGEENLSEPFRYTIEFTSSDKAITPQQMLLQNASLTLQAP
VDQGFGIKIQQPVRVLQGVITAFERLSTAKEETRYALTLQPRLALLSKSHQNRIYQDMSAPQIVEHILRT
RHQMRGEDFVFQLAHEYPQREQVMQYGEDDLTFISRLLGEVGIWFRFTADTRLNIDVAEFYDDQQHYEMG
LSLPSVAPSGQHDGGSESVWDLQSRYHVVERSVFTRDYNYRNAPEDMNLNVNVSRGDSTTYGEAYHWADN
YLTPGNRFQHTPDPESGAFYARIRHERYLNQQTRLNGETNCAALAPGQLLKVSGGEEVTDVWRQGVAIAA
IHCRARRDRSFVMTFQAIPCVETYCFRPAVISKPRMAGTLPARVTSTKINDLYGHIDRDGRYRVNLLFDR
DRWQPGEESLWVRQARPYAGETFGLHLPLLAGTEVAIAFEQGDPDRPYIAGALHDSTHQDHVTLYNYKRN
VLRTPANNKIRLDDTRGKEHVKVSTEYGGKSQLNLGHLVDHQNTPRGEGFELRTDSYGAIRGGKGIFITA
DEQLKAMGATVEMDPANQLLGSAVVQLNDWQEIARTHYNTPPDVSTLKQFVGKAVNLASPVLLMSAPKGI
GIVTAETTLLQSGKGLYLQSASDIALASGNRLSVNTKNAISLLSHREGMRMVSVKGPLEIESHGDTLALT
SLKDITVQSTQGHLQLTAKNGITLGCGGGYIRLTPQGEIHLHSPSLLSFKGSHKMQGPAGETFPLPDLPT
SICKDCLIRAQELAQAFVPRAA
 
Nucleotide Sequence: 2379 bp     [Download]
>gi|444350194|ref|NC_020181.1|:781068-783446 Enterobacter aerogenes EA1509E, complete genome
ATGAGTGACATAAAGCCTCTGTTGTTCAACCACAGCCATCATCTGTTACAGGTGCATGGTTGTAACTCGT
TGCTGGACGTTCTGTGCTTTGAAGGCGAGGAAAACTTAAGCGAGCCTTTCCGCTATACCATTGAATTTAC
CAGCAGCGATAAAGCTATCACCCCGCAGCAGATGTTGCTGCAAAATGCCTCGCTGACCTTGCAGGCGCCG
GTTGACCAGGGATTTGGCATTAAGATCCAGCAACCGGTGCGCGTTCTTCAGGGAGTGATCACCGCTTTTG
AACGGCTTTCCACCGCAAAAGAGGAAACGCGCTACGCCTTGACGTTACAGCCGCGTCTGGCGCTACTGTC
GAAGAGCCATCAGAACCGGATTTATCAGGATATGTCGGCGCCGCAGATTGTGGAGCACATTCTCAGAACC
CGTCACCAGATGCGCGGGGAAGATTTTGTCTTTCAACTGGCGCATGAATACCCGCAGCGTGAACAGGTGA
TGCAGTACGGCGAGGACGATCTGACCTTTATCTCCCGCCTGTTGGGTGAAGTGGGGATCTGGTTTCGCTT
TACCGCCGATACCCGGCTGAATATTGATGTGGCGGAGTTCTACGATGACCAGCAACACTACGAGATGGGA
CTGTCGTTGCCTTCGGTCGCTCCCTCCGGGCAGCATGACGGTGGGAGCGAATCGGTGTGGGACTTACAGA
GCCGATACCACGTGGTTGAGCGTTCGGTCTTTACTCGTGACTATAACTACCGTAACGCGCCAGAGGATAT
GAATCTCAACGTCAATGTCAGCCGCGGCGATAGCACCACCTATGGTGAAGCCTATCACTGGGCGGACAAC
TATCTGACGCCGGGTAATCGCTTCCAGCATACTCCGGACCCGGAGAGCGGGGCCTTTTATGCCCGTATTC
GTCATGAGCGTTATCTCAACCAGCAGACGCGGCTGAATGGGGAAACCAACTGCGCGGCGCTGGCTCCCGG
CCAGCTGCTAAAAGTGAGCGGCGGCGAAGAGGTGACGGACGTCTGGCGCCAGGGGGTGGCGATCGCTGCT
ATTCACTGTCGCGCCCGTCGCGATCGCAGCTTCGTCATGACGTTTCAGGCTATTCCCTGCGTAGAGACTT
ACTGCTTTCGCCCGGCGGTCATCAGCAAACCCAGAATGGCCGGGACGCTGCCGGCGCGCGTCACCAGCAC
CAAAATCAACGATCTCTATGGCCATATCGATCGCGACGGACGTTATCGGGTGAACTTATTGTTCGATCGC
GATCGCTGGCAGCCGGGTGAGGAAAGCCTGTGGGTGCGCCAGGCGCGCCCTTACGCCGGTGAAACCTTTG
GTCTGCATCTGCCGTTGTTAGCGGGCACCGAAGTGGCGATCGCTTTTGAGCAGGGGGATCCCGATAGGCC
CTATATTGCCGGCGCGCTGCACGACTCCACGCACCAGGACCACGTGACGCTCTACAACTACAAGCGTAAC
GTGCTGCGCACGCCGGCGAACAACAAGATTCGCCTCGATGATACACGGGGTAAAGAGCACGTTAAGGTCA
GCACCGAATATGGCGGCAAGAGCCAGCTCAACCTCGGCCACCTGGTGGATCATCAGAACACGCCACGCGG
TGAGGGATTTGAGTTACGCACCGACAGCTACGGCGCGATCCGCGGCGGGAAGGGAATATTTATTACCGCC
GATGAACAGCTGAAAGCGATGGGCGCGACCGTGGAAATGGATCCCGCGAATCAATTGCTCGGCAGTGCCG
TTGTTCAGCTCAACGACTGGCAGGAGATAGCCCGCACCCACTACAACACCCCGCCGGATGTCAGCACGTT
AAAGCAATTCGTCGGCAAAGCCGTCAACCTGGCGAGCCCCGTCCTGCTGATGAGCGCGCCGAAAGGCATC
GGCATCGTGACGGCGGAAACGACGCTGCTACAGAGTGGTAAAGGGTTGTACCTGCAAAGCGCCAGCGATA
TTGCGCTGGCCAGCGGCAACCGGCTGTCGGTGAATACCAAAAACGCAATCTCGCTGCTTTCCCACCGCGA
AGGGATGCGTATGGTATCGGTGAAAGGACCGCTGGAGATAGAGTCGCACGGCGACACGCTGGCGCTCACT
TCACTGAAGGATATTACCGTGCAGTCAACGCAGGGACATCTGCAGCTTACCGCCAAAAATGGCATCACCC
TGGGCTGTGGCGGCGGCTACATTCGCCTGACGCCGCAGGGAGAAATCCATCTTCACAGCCCGAGTCTGCT
CAGTTTTAAAGGCTCGCATAAGATGCAGGGGCCGGCCGGCGAGACGTTTCCGCTCCCCGATCTTCCCACA
TCGATATGTAAAGACTGCCTGATTCGTGCGCAAGAACTGGCTCAGGCTTTTGTGCCACGTGCCGCCTGA