SecReT6
Protein ID: 444350947
SecReT6 ID726
T6SS typeN/A
Gene symbol-
Locus tagST548_p7507
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]795486..797246 [+]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDL8BEI1
KEGG IDear:ST548_p7507
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.50E-180, Aligned region: 6..581
Protein Sequence: 586 a.a.     [Download]
>gi|444350947|ref|YP_007387091.1| Protein ImpG/VasA [Enterobacter aerogenes EA1509E]
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAALNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTGGLVSMIWPHYLRTIPSLAMVEFSVDWREMKEPQRLKKGTEVISRPIGETGTRCRYTTTQPLTLQPLA
LSRASVRAQADGRQAICLRFDCSALVDWRALDLSRIPLYLNADAPLACALHEALTLNVAHIGIRLAGEAD
SRPLAAHFAVCGFGHDDALLPQSGGFSGYQLLLEYFSFREKFMSVALCGLENMTFPDAPGWFEIEVVLDK
PWPQEYALSEKHLRLHCSPVINLFPLESDPLHLDSLQSEYLLRPMRVQDGHTEIYSVESVTSSRLSGTQV
YVPFTSFRHKGGMLRHDAPEYYYHTRVKRGPSGLHDTWLTLGGEAFDQHRVPQNETLSLSLIGTNGQLPR
RALQSTLLDTVVKSTTSRLQVRNLSAPTLPCYPPDRDRFHWRVLSHLGSSFLWMMDNAEVLRGALALYDW
TDNEMNRRRLQAIVDVSHCEVERFAEGHFLRGVQIEVTLDGNGFAGHGDICLFGELLNRFFALYTDIHLF
NRLILILQPTGERLEWQENHKRRIPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|444350194|ref|NC_020181.1|:795486-797246 Enterobacter aerogenes EA1509E, complete genome
ATGGACGATTTAACTCTGCGTTATTTTGACGCTGAAATGCGCTATCTGCGTGAGGCTGGCGAGGAGTTTG
CCCGCGCCCATCCCGATCGCGCCGCGGCGTTAAACCTCGATAAAGCCGGCGCCCGTGATCCCTATGTTGA
GCGCCTGTTCGAAGGCTTTGCTTTCCTGATGGGGCGGCTGCGCGAAAAGCTCGACGACGACCTGCCGGAG
CTGACCGGCGGGCTGGTGAGTATGATCTGGCCGCATTATCTCCGTACCATTCCGTCGCTGGCGATGGTGG
AGTTCAGCGTCGACTGGCGGGAGATGAAAGAGCCGCAGCGGCTGAAGAAGGGAACGGAAGTGATCTCCCG
GCCCATCGGCGAGACGGGCACCCGCTGCCGTTACACCACGACCCAGCCGCTAACCTTACAGCCGCTCGCG
CTCTCCCGCGCCAGCGTCAGGGCGCAGGCCGACGGCCGCCAGGCGATTTGTCTGCGTTTTGACTGTAGCG
CGCTGGTGGACTGGCGGGCGCTCGACCTGAGCCGTATTCCGTTGTATCTGAATGCCGATGCGCCATTGGC
CTGCGCGCTGCATGAAGCGCTGACCCTGAATGTGGCGCACATCGGCATACGTCTGGCGGGGGAGGCCGAT
AGCAGGCCGCTGGCGGCCCATTTTGCCGTTTGCGGTTTTGGCCATGATGATGCGCTGCTGCCCCAAAGCG
GCGGGTTCAGCGGCTACCAGTTGCTGCTGGAGTATTTCAGCTTTCGTGAAAAGTTTATGTCGGTCGCGCT
GTGCGGGCTGGAGAATATGACGTTTCCTGATGCGCCGGGATGGTTTGAGATCGAGGTCGTGCTGGATAAA
CCGTGGCCGCAGGAGTATGCGTTGTCAGAGAAACATCTGCGTTTACACTGCAGCCCGGTTATTAACCTGT
TCCCGCTGGAGTCGGATCCGCTGCATCTGGATTCACTACAAAGTGAGTATCTGCTGCGCCCCATGCGCGT
CCAGGATGGACACACCGAAATCTATTCGGTGGAGTCCGTCACCTCTTCACGTCTTTCCGGCACCCAAGTG
TATGTGCCGTTTACCAGTTTTCGCCACAAAGGCGGCATGTTGCGCCATGATGCGCCGGAATATTATTACC
ACACGCGCGTTAAACGTGGCCCGTCCGGGCTGCATGATACCTGGCTGACGCTGGGCGGCGAGGCGTTTGA
CCAGCATCGCGTGCCGCAGAATGAAACCCTGTCATTGAGCCTGATCGGCACCAACGGCCAGTTGCCGCGG
CGGGCGCTGCAAAGCACGCTGCTGGACACGGTGGTCAAATCCACGACGTCGCGACTCCAGGTGCGCAATC
TCAGCGCGCCGACGTTGCCGTGTTATCCACCGGATCGCGACCGTTTTCACTGGCGGGTACTGAGCCATCT
CGGTAGCAGCTTCCTGTGGATGATGGATAACGCCGAGGTGTTGCGCGGCGCGCTGGCGTTGTACGACTGG
ACGGACAACGAAATGAACCGCCGTCGCCTGCAGGCGATCGTCGACGTGAGCCACTGTGAGGTGGAACGTT
TTGCCGAGGGGCACTTTCTACGCGGCGTGCAGATAGAGGTGACGCTCGACGGTAACGGCTTCGCCGGACA
CGGCGACATCTGCCTGTTTGGCGAGCTGCTCAACCGCTTCTTTGCCCTGTATACCGACATCCATCTGTTT
AATCGTCTGATTCTGATACTGCAACCTACCGGAGAGCGTCTCGAATGGCAGGAGAACCACAAACGCCGCA
TTCCCGGCTGA