SecReT6
Protein ID: 444350948
SecReT6 ID726
T6SS typeN/A
Gene symbol-
Locus tagST548_p7506
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]797210..798295 [+]
ProductUncharacterized protein ImpH/VasB
NoteTssG
UniProt IDL8BFJ1
KEGG IDear:ST548_p7506
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.10E-76, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|444350948|ref|YP_007387092.1| Uncharacterized protein ImpH/VasB [Enterobacter aerogenes EA1509E]
MAGEPQTPHSRLSPRLERDIQRINFYRFCQLLEKSRPGAPALGSTLNPADDPVRFRPHPGMGFPVSELKA
VEYDEAHPDAPPTLRTTFMGLYGVDSPLPTAWLDDIAQQREGHEAQEAFLDIFNHRILSQFYRIWRKYSY
PATFEDGGRDRTSQSLLGLIGLGIPGTAQHIAAPVSRFLALLSVMRLPARTEEGIQALVRLLAPHTRAEA
SPHCPRTVYPAQPLGFYGDNDFLLDGYTVLGEETTEIASQLLIALYTDDIAEAAGWMPEGQIYADFLVLL
RVYLGWRYKAKITLTLPTPLLPAPVLGETPFMLGISGVLGMEGDAVPPDLPATFTTELGGYRGMPLASLS
QGNQRVEYHFA
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|444350194|ref|NC_020181.1|:797210-798295 Enterobacter aerogenes EA1509E, complete genome
ATGGCAGGAGAACCACAAACGCCGCATTCCCGGCTGAGCCCGCGGCTGGAGCGGGATATTCAGCGCATCA
ACTTTTACCGTTTCTGCCAGCTACTGGAAAAATCGCGACCTGGCGCGCCGGCATTAGGCAGCACGCTGAA
CCCGGCGGATGATCCGGTACGCTTTCGCCCGCATCCGGGGATGGGTTTTCCGGTCAGCGAACTCAAAGCG
GTGGAGTATGATGAGGCGCATCCCGACGCGCCGCCGACGCTGCGCACCACCTTTATGGGGCTATACGGTG
TCGATTCGCCGTTGCCCACCGCCTGGCTGGATGATATTGCGCAGCAAAGAGAAGGGCATGAGGCGCAGGA
AGCATTTCTCGATATTTTTAACCACCGCATTCTGAGCCAGTTTTATCGCATCTGGCGCAAATACTCGTAT
CCGGCAACCTTTGAAGACGGCGGTCGCGACCGTACTTCGCAGAGCCTGCTGGGGCTGATCGGGCTGGGCA
TTCCCGGCACCGCTCAGCATATTGCCGCGCCGGTATCTCGCTTTCTGGCATTACTCAGCGTGATGCGCCT
GCCTGCGCGTACCGAAGAGGGAATTCAGGCGCTGGTACGATTGTTGGCGCCCCATACGCGGGCGGAAGCG
TCGCCGCACTGCCCACGGACGGTGTACCCGGCGCAGCCGCTGGGTTTTTACGGCGATAACGATTTCCTGC
TTGATGGCTACACGGTGCTGGGCGAGGAAACGACCGAGATTGCCAGCCAGTTGCTGATCGCGCTGTACAC
CGATGATATCGCCGAGGCCGCAGGCTGGATGCCGGAAGGGCAAATCTATGCGGACTTTCTGGTTCTGCTG
CGGGTTTATCTCGGCTGGCGCTATAAGGCCAAAATCACCTTAACGCTTCCCACGCCGCTGTTACCCGCGC
CGGTACTTGGCGAAACGCCGTTTATGCTCGGCATAAGCGGCGTTCTGGGCATGGAGGGGGACGCGGTTCC
GCCGGATTTACCGGCCACGTTTACCACGGAACTGGGCGGCTACCGCGGCATGCCGCTTGCATCATTATCA
CAAGGAAACCAACGTGTTGAATATCACTTCGCTTAA