SecReT6
Protein ID: 444350949
SecReT6 ID726
T6SS typeN/A
Gene symbol-
Locus tagST548_p7505
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]798273..798812 [+]
ProductProbable lipoprotein
NoteTssJ
UniProt IDL8BES7
KEGG IDear:ST548_p7505
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-35, Aligned region: 17..169
Protein Sequence: 179 a.a.     [Download]
>gi|444350949|ref|YP_007387093.1| Probable lipoprotein [Enterobacter aerogenes EA1509E]
MLNITSLKLSALILLPFMLAGCGLTQKISDGASSAVKSVFYRQVKTLRLDFSARNALNTDNREDNSASQP
VMVRVYVLKDRKTFDKTVYQQLAAEGEEILKDDQLASRSLVLKPGTAMSLTMPLDEQAQYVAVVALFRAP
DLTKNDWKLVLAREDLDPDRARVIEASHHQLVLQPRKEK
 
Nucleotide Sequence: 540 bp     [Download]
>gi|444350194|ref|NC_020181.1|:798273-798812 Enterobacter aerogenes EA1509E, complete genome
GTGTTGAATATCACTTCGCTTAAACTATCCGCACTGATTCTTCTGCCGTTCATGCTGGCGGGTTGTGGGC
TAACACAGAAAATCAGCGACGGCGCTTCGTCCGCCGTAAAGTCAGTATTTTATCGCCAGGTGAAAACGCT
GCGTCTGGATTTTAGCGCGCGCAATGCGTTAAACACCGATAACCGCGAGGATAACAGCGCCTCCCAGCCG
GTGATGGTGCGGGTCTATGTGCTGAAGGATCGCAAGACTTTCGATAAGACGGTTTACCAGCAGCTGGCGG
CGGAGGGGGAGGAGATATTAAAAGACGACCAACTGGCCAGCCGCAGCCTGGTGCTCAAACCGGGAACGGC
GATGAGTCTCACCATGCCGCTGGATGAACAGGCGCAGTATGTTGCCGTGGTGGCGCTGTTTCGGGCGCCG
GATCTGACGAAAAACGACTGGAAGCTGGTGCTTGCCCGTGAGGATCTTGACCCGGACCGCGCGCGCGTCA
TTGAGGCCAGCCATCATCAACTTGTTCTGCAACCGCGGAAGGAGAAGTGA