SecReT6
Protein ID: 444350955
SecReT6 ID726
T6SS typeN/A
Gene symbol-
Locus tagST548_p7499
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]801247..803463 [+]
ProductVgrG protein
NoteTssI
UniProt IDL8BC07
KEGG IDear:ST548_p7499
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.10E-69, Aligned region: 24..328
Phage_GPD [PF05954], Evalue: 6.10E-69, Aligned region: 563..637
Phage_GPD [PF05954], Evalue: 6.10E-69, Aligned region: 663..694
Phage_base_V [PF04717], Evalue: 2.90E-26, Aligned region: 366..459
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 502..524
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 526..548
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 550..572
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 573..596
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 582..604
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 598..619
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 606..627
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 621..640
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 630..651
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 642..659
Gp5_C [PF06715], Evalue: 2.30E-20, Aligned region: 665..679
Protein Sequence: 738 a.a.     [Download]
>gi|444350955|ref|YP_007387099.1| VgrG protein [Enterobacter aerogenes EA1509E]
MVNRISILSSVDSSSLLFWKFSGQEKLSEPFHFQVDLLSQDFAIDRQAMLGKNMTVAVPGQWGQERYLSG
KITAVTVRAEDLGETRYAVYQTTLEPDFWPMMRDRNFRIFQQQRVPDIVAKLFSEHNVKFEDKLTRSYRQ
WDYCVQYAESSFHFISRLLELEGISYLFRHDKDGHTLVLMDDYQQTESFPGYETIPWHAQPGGGAVGEEG
ISQLMASHVVTPGLYSTDDYDFRKPHAWMLQTLQNPVSPTPGKIDVYDWPGRFMEHGDGEAYARIRQQSW
QAEQQQTQGIATATGIVPGHTFTLTHAPNMADNAKWLVVGARYDFEENQYASGGGNTAQHRIAFTVIPAA
TPFVPASRTDWPRTYGPQTARVVGPKGESIWTDKYGRIKVKFHWDRESQGDENSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGEPDRPIVIGRVYNEASMPPWALPAAATQMGFMSRSKDGSPDNANALRFEDKP
GEEQLWLHAERNMDTEVENDETHDVGNNRTKTVGKDETSHIKQNRTRTVDGNESVTVGKDRSKTINGNET
TTVEQNRTESVKGNETLSVEQNRDETISGNHTTTVKSDHTATVEGKQSLTVVQDRTRQVQGNESVSVQQN
RNVQVTGNQTLGVTGNHDISVTGKQTQTITSKQEVTIGAGRTLSITGGDTRFTQGSVTDSATDTVHINVG
ESGILISNGSVEITAGGSTITINAAGVMVNGKKIELNA
 
Nucleotide Sequence: 2217 bp     [Download]
>gi|444350194|ref|NC_020181.1|:801247-803463 Enterobacter aerogenes EA1509E, complete genome
ATGGTTAATCGGATATCGATCCTGTCATCTGTCGACAGCTCCTCGTTATTATTCTGGAAATTCAGCGGGC
AGGAGAAACTGTCCGAACCTTTCCACTTTCAGGTCGATTTACTCAGCCAGGATTTTGCTATCGACCGTCA
GGCCATGCTCGGCAAAAACATGACGGTGGCGGTTCCCGGCCAATGGGGACAGGAGCGTTATCTTTCCGGC
AAAATCACCGCCGTTACCGTACGCGCCGAAGATCTTGGCGAGACGCGCTACGCCGTCTATCAGACCACGC
TGGAACCCGATTTCTGGCCGATGATGCGCGACCGCAACTTCCGTATTTTCCAGCAGCAGCGGGTGCCGGA
TATCGTGGCCAAACTGTTTAGCGAGCATAACGTTAAGTTTGAGGACAAACTTACGCGTAGCTACCGGCAG
TGGGATTATTGTGTACAGTACGCGGAAAGCAGCTTCCATTTCATCAGCCGTTTGCTGGAGCTGGAAGGTA
TTAGCTATCTGTTCCGCCACGATAAAGACGGCCATACCCTGGTGCTGATGGATGACTATCAGCAGACTGA
ATCCTTCCCCGGTTATGAAACTATTCCCTGGCATGCGCAACCGGGCGGCGGCGCGGTCGGCGAAGAGGGC
ATCAGCCAGCTGATGGCGAGCCACGTCGTCACGCCGGGGCTTTACAGCACCGATGACTATGATTTTCGCA
AGCCCCACGCCTGGATGCTGCAAACGCTGCAGAATCCGGTCTCGCCGACACCGGGCAAAATCGACGTTTA
CGACTGGCCGGGGCGCTTTATGGAGCACGGCGACGGCGAAGCCTACGCCCGTATTCGTCAGCAGTCCTGG
CAGGCCGAACAGCAGCAAACGCAGGGTATCGCCACCGCGACCGGTATCGTCCCGGGACACACGTTTACCC
TGACGCATGCGCCTAACATGGCTGATAACGCTAAATGGCTGGTGGTGGGCGCCCGCTATGATTTTGAAGA
GAATCAGTATGCCTCCGGTGGCGGAAATACCGCGCAGCACCGCATCGCATTCACCGTTATTCCCGCCGCG
ACGCCATTTGTCCCTGCGTCAAGGACCGACTGGCCGCGCACCTACGGGCCGCAAACCGCCCGCGTGGTAG
GGCCGAAAGGAGAATCGATCTGGACCGATAAATATGGCCGGATTAAGGTGAAATTCCACTGGGACCGCGA
AAGCCAGGGCGATGAAAATAGCTCCTGTTGGGTGCGCGTTTCCAGCGCCTGGGCCGGCCAGGGTTACGGC
GGGGTGCAGATCCCACGCGTCGGTGATGAAGTGGTGGTGGACTTTATTAACGGTGAGCCGGACCGGCCGA
TTGTCATTGGCCGCGTCTATAACGAAGCCAGTATGCCGCCGTGGGCGCTACCGGCGGCAGCCACGCAGAT
GGGTTTTATGAGCCGTTCAAAGGATGGTTCGCCGGACAACGCCAACGCCCTGCGTTTTGAAGATAAACCC
GGCGAAGAGCAGCTCTGGCTGCACGCCGAGCGCAACATGGATACTGAAGTCGAAAACGACGAGACCCATG
ATGTCGGCAATAACCGCACCAAAACCGTCGGCAAAGACGAAACCAGCCATATCAAACAGAACCGCACCCG
CACGGTGGATGGCAATGAAAGCGTTACCGTCGGCAAAGATCGCAGCAAAACCATCAATGGTAATGAAACC
ACCACCGTTGAGCAGAACCGTACCGAAAGCGTGAAGGGGAATGAGACCCTAAGCGTTGAGCAGAACCGCG
ATGAAACCATCAGCGGCAACCATACCACCACGGTGAAAAGCGACCATACCGCGACCGTCGAAGGCAAGCA
GTCACTGACGGTCGTACAGGATCGCACCCGTCAGGTGCAGGGTAACGAAAGCGTCAGCGTCCAGCAGAAC
CGTAACGTGCAGGTCACCGGCAACCAGACGCTAGGAGTGACCGGCAATCACGATATTTCCGTGACCGGTA
AGCAAACGCAGACCATCACCAGTAAGCAAGAGGTGACGATCGGCGCCGGGCGTACCCTGAGCATCACCGG
CGGTGATACCCGCTTTACGCAAGGGAGCGTAACCGACAGCGCTACCGATACCGTACATATCAACGTGGGC
GAAAGCGGCATTCTGATAAGCAACGGCAGCGTGGAGATTACCGCTGGCGGGTCGACGATCACCATTAACG
CCGCCGGCGTGATGGTGAATGGTAAGAAGATTGAGCTCAATGCCTGA