SecReT6
Protein ID: 444351137
SecReT6 ID503
T6SS typei2
Gene symbol-
Locus tagST548_p7317
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]987040..987531 [+]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDL8BF37
KEGG IDear:ST548_p7317
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-52, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|444351137|ref|YP_007387281.1| Uncharacterized protein ImpB [Enterobacter aerogenes EA1509E]
MADSFQNEVPKARINLKLSLHTGGAQKKVELPLKLLTVGDFSNGKEHRPLAERQKIDINKNNFNSVLSEF
NPEINLTVENTLAGDNSEDNVKLRFSDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
ERILKDPALSSELRAEMSALAGK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|444350194|ref|NC_020181.1|:987040-987531 Enterobacter aerogenes EA1509E, complete genome
ATGGCTGATTCATTCCAGAATGAGGTGCCGAAGGCACGTATTAATTTAAAATTATCCTTACATACCGGGG
GGGCGCAGAAGAAGGTTGAACTACCGCTTAAATTGCTCACCGTTGGTGATTTCAGTAATGGAAAAGAGCA
TCGACCATTGGCCGAGCGCCAGAAAATAGATATCAATAAGAATAATTTTAATAGTGTGCTTTCTGAATTT
AACCCAGAGATCAATCTCACCGTTGAGAATACGCTGGCCGGTGATAACTCAGAAGACAATGTTAAACTGC
GTTTTTCCGATATAAAAGACTTTGAGCCCGAACAGGTTGCCCGGCAAATCCCTCAACTCCGCGCCATGCT
GGCGATGCGTAATTTATTACGCGATCTCAAATCGAACCTGCTAGATAACGCTACTTTCAGAAAAGAGCTT
GAGAGAATCCTTAAAGATCCAGCTCTGTCCAGCGAATTACGCGCCGAAATGAGTGCCCTTGCCGGGAAGT
AA