SecReT6
Protein ID: 444351138
SecReT6 ID503
T6SS typei2
Gene symbol-
Locus tagST548_p7316
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]987568..989109 [+]
ProductUncharacterized protein ImpC
NoteTssC
UniProt IDL8BG62
KEGG IDear:ST548_p7316
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.60E-174, Aligned region: 87..509
Protein Sequence: 513 a.a.     [Download]
>gi|444351138|ref|YP_007387282.1| Uncharacterized protein ImpC [Enterobacter aerogenes EA1509E]
MLMSVNTETNPAQGQTAVMNKESVYASLFEKINLSPASSLGNINVFLDDAALSEATAGERLTAAMQVFMD
CIRQSGQQVEKLDKTLIDHHIAELDFRISRQLDAVMHHPEFQKVESLWRGLKQLVDNTDYRQNVKTEILD
VSKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISAYEFDASPQDMALLRNISKVSAAAHMP
FIGAVGPKFFLKDSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYIGLVMPRVLGRLPYGPDTVPVRS
FNYIEQVKGPDHEKYLWTSASFAFASNMVRSFIQNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNTWVRGLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLYAV
PHFQVEGMDVNLSLVSQMPKAKG
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|444350194|ref|NC_020181.1|:987568-989109 Enterobacter aerogenes EA1509E, complete genome
ATGCTGATGTCTGTAAATACTGAAACGAACCCCGCGCAGGGGCAAACCGCCGTAATGAACAAAGAAAGCG
TTTACGCTTCTCTGTTTGAAAAAATCAATCTGAGCCCGGCATCAAGCCTTGGCAATATTAATGTCTTTCT
GGACGATGCGGCGCTATCAGAGGCCACTGCGGGAGAACGCCTGACCGCGGCGATGCAGGTTTTTATGGAC
TGCATTCGTCAATCCGGTCAGCAGGTGGAGAAACTCGATAAAACGCTTATTGACCACCACATCGCGGAGC
TGGATTTCCGTATCAGCCGTCAACTCGATGCTGTTATGCATCACCCGGAGTTCCAGAAGGTGGAGTCTCT
GTGGCGCGGCCTGAAGCAACTGGTAGATAACACCGACTATCGCCAGAACGTGAAAACCGAAATCCTCGAT
GTGTCCAAAGACGATTTACGTCAGGATTTTGAAGATGCGCCAGAGCTGATACAGAGCGGCCTGTACTGGC
ATACTTACACCGCCGAATACGACACTCCCGGCGGCGAGCCGATAGGCTCGGTAATTTCAGCGTACGAGTT
TGACGCCAGCCCGCAGGACATGGCGCTGTTGCGTAATATTTCGAAAGTCTCCGCTGCGGCGCATATGCCA
TTTATCGGCGCCGTTGGGCCGAAATTTTTTCTCAAGGATTCAATGGAGGAAGTCGCGGCGATTAAAGATA
TCGGCAACTATTTCGATCGCGCTGAGTACATTAAATGGAAATCGTTCCGCGATACCGATGACTCGCGCTA
TATCGGCCTGGTCATGCCGCGGGTATTGGGCCGTCTGCCGTATGGGCCGGACACGGTTCCGGTGCGCAGC
TTTAACTACATTGAGCAGGTAAAGGGGCCGGATCATGAAAAGTATCTGTGGACCAGCGCGTCATTCGCCT
TCGCCTCGAACATGGTACGCAGCTTTATTCAAAACGGCTGGTGCGTGCAAATCCGCGGCCCGCAGGCGGG
CGGCGCGGTGAAAGATCTTCCCATCCACCTCTATGATCTCGGCACTGGAAATCAGGTGAAAATCCCTTCC
GAGGTGATGATCCCGGAAACCCGTGAGTTCGAATTCGCCAATCTGGGCTTTATTCCGCTGTCTTATTATA
AAAACCGTGACTACGCCTGCTTCTTCTCGGCTAACTCAACCCAGAAACCCGCGCTGTACGACACCGCGGA
TGCGACAGCCAATAGCCGTATCAACGCCCGCCTGCCGTACATCTTCCTGCTGTCGCGCATCGCCCACTAC
CTGAAACTGATCCAACGCGAGAACATCGGCACCACCAAAGATCGTCGCCTGCTTGAGCTGGAGCTCAATA
CCTGGGTTCGTGGCCTGGTTACGGAAATGACCGATCCGGGTGACGAGCTGCAGGCCTCACATCCGCTGCG
TGATGCGAAAGTGGTAGTGGAAGATATCGAGGATAATCCAGGCTTCTTCCGCGTCAAGCTGTACGCGGTG
CCGCACTTCCAGGTGGAAGGCATGGACGTCAATTTGTCTCTGGTTAGCCAGATGCCGAAGGCGAAAGGGT
AA