SecReT6
Protein ID: 444351139
SecReT6 ID503
T6SS typei2
Gene symbol-
Locus tagST548_p7315
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]989229..989720 [+]
ProductPutative cytoplasmic protein USSDB7A
NoteTssD
UniProt IDL8BFE0
KEGG IDear:ST548_p7315
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.80E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|444351139|ref|YP_007387283.1| Putative cytoplasmic protein USSDB7A [Enterobacter aerogenes EA1509E]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPLMHDIKNPAYEKHSHLEQIELRYE
KITWTYKDGNIIHSDSWNERTTA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|444350194|ref|NC_020181.1|:989229-989720 Enterobacter aerogenes EA1509E, complete genome
ATGGCAATACCAGTCTATTTGTGGTTGAAAGACGACGGCGGGGCGGACATTAAAGGTTCCGTGGATGTGA
AAGATCGGGAAGGCAGCATCGAAGTGGTGGCGCAGGAGCATAACCTGTACATCCCGACCGACAACAACAC
CGGAAAGCTAACCGGCACGCGTATCCACACGCCGTTTCTGTTTACCAAGGAAATCGACTCCTCAAGCCCC
TATCTCTACAAGGCGGTGACTACCGGCCAGACGCTGAAGTCTGCCGAATTCAAGTGGTACAAAATCAATG
ATGCTGGTCAGGAAGTGGAATACTTCAACACAAAACTGGAAAACGTGAAAGTGGTGAAGGTCAATCCGCT
GATGCACGACATCAAGAACCCAGCCTACGAGAAGCACAGCCATCTTGAGCAGATTGAACTGCGCTACGAA
AAAATCACCTGGACCTATAAAGACGGCAACATCATTCATTCCGATTCATGGAATGAACGAACGACAGCCT
GA