SecReT6
Protein ID: 444351394
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7060
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1253738..1254244 [+]
ProductType VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDL8BG50
KEGG IDear:ST548_p7060
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.20E-32, Aligned region: 20..150
Protein Sequence: 168 a.a.     [Download]
>gi|444351394|ref|YP_007387538.1| Type VI secretion lipoprotein/VasD [Enterobacter aerogenes EA1509E]
MNNNSLLRQVMLAFYLFLFTLVSGCGSSSHSDPARYNLQFQAHPQINRSAPLKVRVLVLKSDAEFMSADF
YSLQNNAQKVLAGNLLNSDEFFLMPGQLAKKLSGQSSPEARYIGVMAEYQSLDGKKWRISLPLPTPGETP
FWQFWKLSADQLQANLYLDVNGIRVVQQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1253738-1254244 Enterobacter aerogenes EA1509E, complete genome
ATGAATAATAACTCTCTTTTACGCCAGGTCATGCTGGCGTTTTATTTGTTTCTTTTTACGTTGGTTAGTG
GATGTGGTTCGTCTTCACACAGCGACCCTGCCCGATACAATCTTCAGTTCCAGGCCCACCCGCAAATTAA
CCGTTCTGCGCCATTAAAGGTCAGAGTGTTAGTGCTGAAATCCGATGCGGAATTCATGTCCGCCGATTTC
TACTCCTTACAAAATAACGCGCAAAAAGTTCTCGCCGGCAACTTGCTGAACAGCGATGAATTTTTCCTGA
TGCCGGGGCAACTGGCAAAAAAACTCAGCGGGCAAAGCTCGCCGGAGGCGCGTTATATCGGAGTGATGGC
GGAATACCAATCTCTGGATGGTAAAAAGTGGCGCATTTCTCTTCCTCTGCCAACGCCTGGCGAAACCCCT
TTCTGGCAGTTCTGGAAACTGTCGGCAGATCAACTGCAAGCCAATTTATATCTTGACGTTAACGGGATCC
GCGTCGTGCAGCAATAG