SecReT6
Protein ID: 444351395
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7059
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1254269..1255612 [+]
ProductUncharacterized protein ImpJ/VasE
NoteTssK
UniProt IDL8BD07
KEGG IDear:ST548_p7059
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.90E-134, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|444351395|ref|YP_007387539.1| Uncharacterized protein ImpJ/VasE [Enterobacter aerogenes EA1509E]
MNKAEKVVWTEGMFLRPHHFQRAESYLQTQIREWGGLQRSWLWGFLEIELDDAMLRQGCIALSYASGLLP
DGTFFQFRDARQGPAPLQIPDNVTGEKVVLALPVRRGGREEVIFSEEKDSLARFTAFEQDVEDDNALSVG
DATVQFARPRLTLMLEKDLTAEWTAIGVAFIAEKRNDNAVKLDNGYIPPMLNGINHPLIYAMINDLHGLL
AQRSQQIGSRLRQPGRFNTSELIEFTLLALVNRHLGHLSHLKTLPLVHPESLWNSWLPFAAELTTWMAQR
GPDAALPIYDHDDLASCFGKLMLLLRQGLSQVMEDNAIQLPLIERSHGLNIATVPESSMVRDFGFVLAVK
ASVPGDVLQTHFPAQMKVAPVSKIRDLVQLQLPGLILRAMPAAPPQIPWHAGYNYFAVEKGGELWNDMEK
SGAFALHLAGEFPGLDMEFWAIRSPSE
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1254269-1255612 Enterobacter aerogenes EA1509E, complete genome
ATGAATAAAGCAGAAAAGGTGGTCTGGACCGAGGGTATGTTTTTGCGTCCGCATCACTTTCAGCGGGCAG
AAAGCTACCTGCAAACGCAAATTCGCGAATGGGGCGGATTACAGCGCTCCTGGCTGTGGGGTTTTCTTGA
GATTGAACTTGATGATGCGATGCTGCGTCAGGGGTGCATTGCCCTGAGCTATGCCAGCGGCCTGCTGCCG
GATGGGACTTTCTTCCAGTTTCGCGATGCTCGTCAGGGCCCGGCGCCGTTGCAAATCCCGGATAACGTCA
CGGGCGAAAAAGTCGTATTGGCCTTGCCGGTACGCCGCGGCGGTCGGGAAGAGGTTATCTTCAGCGAGGA
AAAAGACTCGCTGGCGCGATTTACCGCGTTTGAACAGGATGTGGAAGATGACAATGCGCTGTCGGTTGGC
GATGCCACCGTGCAGTTTGCCCGCCCGCGGCTCACCCTGATGCTGGAAAAGGATTTAACCGCCGAGTGGA
CGGCCATCGGCGTGGCGTTCATCGCCGAAAAGCGCAACGATAACGCCGTAAAACTCGATAATGGCTATAT
CCCGCCGATGCTTAACGGCATCAATCATCCTTTGATTTACGCGATGATCAACGACTTGCATGGTCTGCTG
GCGCAGCGTAGCCAGCAAATCGGCAGCCGGCTCCGACAGCCGGGGCGTTTTAATACTTCCGAATTAATTG
AGTTCACTCTACTTGCGTTGGTCAATCGCCATCTCGGCCATCTCTCACATCTCAAAACGCTGCCGTTAGT
TCATCCCGAGTCATTGTGGAATAGCTGGCTGCCGTTCGCCGCCGAGCTGACGACCTGGATGGCGCAGCGC
GGTCCGGATGCTGCGCTGCCGATTTACGACCATGACGATCTCGCGAGCTGCTTCGGCAAACTGATGCTGT
TGCTGCGCCAGGGGTTATCACAGGTAATGGAAGACAATGCCATCCAACTGCCGCTGATAGAACGATCGCA
TGGGTTGAACATCGCAACGGTACCCGAGAGCAGCATGGTGCGTGATTTCGGATTCGTATTGGCAGTTAAA
GCCAGCGTACCAGGTGATGTTCTGCAAACGCACTTCCCGGCGCAGATGAAAGTCGCGCCGGTGAGCAAAA
TTCGCGATCTGGTGCAACTACAGCTTCCGGGTTTAATTCTGCGCGCTATGCCCGCCGCGCCGCCGCAAAT
TCCGTGGCATGCCGGTTACAACTACTTTGCAGTCGAGAAGGGCGGCGAGCTGTGGAACGACATGGAGAAA
TCTGGCGCCTTCGCCCTGCATCTGGCAGGCGAGTTCCCCGGCCTGGATATGGAATTTTGGGCTATCCGTA
GCCCGTCGGAATAA