SecReT6
Protein ID: 444351396
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7058
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1255627..1256856 [+]
ProductOuter membrane protein ImpK/VasF, OmpA/MotB domain
NoteTssL
UniProt IDL8BDR9
KEGG IDear:ST548_p7058
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.10E-68, Aligned region: 17..222
DUF2077 [PF09850], Evalue: 9.10E-68, Aligned region: 349..386
OmpA [PF00691], Evalue: 7.20E-16, Aligned region: 204..224
OmpA [PF00691], Evalue: 7.20E-16, Aligned region: 287..385
Protein Sequence: 409 a.a.     [Download]
>gi|444351396|ref|YP_007387540.1| Outer membrane protein ImpK/VasF, OmpA/MotB domain [Enterobacter aerogenes EA1509E]
MMQEQQADANHGVSGNNPLVTAANPLLNAIPQIRHSVSHDDQAGLRQRLIDEIRRFEVRGQQAGLPYEVI
VGARYCLCTALDEAAALTPWGSSGVWSGSGLLVTFHNETWGGEKFFQLLARLSQNPREHINLLELINYCL
LLGFEGRYRVMDNGRTQLETIKQRLWQMICGVRGGYAPPLSVHGEDRPVLRKLWRPVVPLWACVALAGFA
ASLFYIILNWRLGDATNPVLAKIYQTPLPEASIAQPAEKLPAVLNLRGFLRPEIAEGLVAVRDEADRSVV
ILKGDGLFASASTVVRDRYDPVIDRIAQAMNNVSGRILVVGYSDNVPIRSARFASNYELSLERARSVQKQ
LQNHLTQPERVKAEGRGEMNPIAPNTTPENRARNRRVEITLLVSPDNTRAELNGLPQGN
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1255627-1256856 Enterobacter aerogenes EA1509E, complete genome
ATGATGCAGGAACAACAGGCCGATGCCAACCATGGCGTGAGCGGCAATAATCCCCTGGTGACGGCCGCCA
ACCCATTACTTAATGCGATTCCCCAGATCCGTCATTCGGTATCGCACGATGACCAGGCCGGTTTGCGCCA
GCGTTTGATTGATGAAATCCGCCGTTTTGAAGTGCGCGGTCAGCAGGCGGGGTTACCCTACGAAGTGATA
GTCGGCGCCCGTTACTGCCTGTGTACCGCACTGGACGAGGCTGCGGCCTTGACGCCATGGGGGAGTAGCG
GCGTCTGGTCGGGCAGCGGTCTTTTAGTGACCTTTCATAACGAAACCTGGGGCGGGGAGAAGTTTTTCCA
GCTGCTTGCACGCCTGTCGCAGAATCCGCGCGAACATATCAATCTGTTGGAACTGATCAACTACTGCTTA
TTGCTCGGCTTTGAAGGGCGTTACCGGGTAATGGATAACGGCCGCACGCAGTTGGAAACCATCAAACAGC
GCCTGTGGCAGATGATTTGCGGCGTACGCGGCGGCTACGCGCCGCCGTTATCGGTTCACGGCGAGGATCG
CCCGGTGCTGCGTAAACTGTGGCGTCCGGTGGTGCCGCTGTGGGCCTGCGTCGCGCTGGCGGGGTTCGCC
GCCTCTCTGTTCTATATCATTCTTAACTGGCGGCTTGGCGATGCTACCAACCCGGTGTTGGCGAAAATTT
ACCAGACGCCGTTGCCGGAAGCGTCGATTGCTCAGCCGGCGGAAAAATTGCCGGCGGTACTTAACCTGCG
AGGTTTTCTGCGCCCGGAAATTGCCGAAGGGCTGGTTGCGGTCCGTGACGAAGCGGACCGCAGCGTGGTG
ATCCTCAAAGGCGACGGGCTCTTTGCTTCGGCCTCAACGGTGGTGCGCGATCGCTACGACCCGGTCATTG
ACCGTATTGCGCAAGCGATGAACAACGTCAGCGGCCGCATTCTGGTGGTCGGCTATAGCGATAACGTGCC
TATCCGCAGCGCGCGCTTTGCCTCGAACTACGAGCTGTCGCTGGAACGCGCGCGTTCGGTACAAAAACAA
CTGCAAAATCATCTGACGCAGCCCGAACGCGTAAAAGCCGAAGGGCGAGGGGAAATGAACCCCATCGCGC
CGAATACCACTCCTGAGAACCGTGCCCGTAACCGCCGTGTGGAAATTACTCTGCTGGTGTCGCCCGATAA
TACCCGGGCTGAGCTGAACGGATTGCCCCAAGGAAATTAA