SecReT6
Protein ID: 444351399
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7055
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1261206..1262216 [+]
ProductUncharacterized protein ImpA
NoteTssA
UniProt IDL8BG55
KEGG IDear:ST548_p7055
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.00E-17, Aligned region: 52..111
Protein Sequence: 336 a.a.     [Download]
>gi|444351399|ref|YP_007387543.1| Uncharacterized protein ImpA [Enterobacter aerogenes EA1509E]
MNIDEFLAPVSAEQPCGENLEYDADFQAMEQAMQGKAEQQFGDTIIPAEPADWTTVEKLAAGLLSRTKDL
RVMLALTQAWTKRRGLSGYADGLLLVQQALSLYWQPIYPLLEEYGETDPFYRINALAGLSDKSALTSALR
NAVLLRSNGDELLLRDAQALLDGSKTECADYPGGRSRLIDELARGGQPGIDAILAIHQRLQTIREILCDC
LGESGVPEMEQLQKTVGIVAGACQITDISSFHASREESAVSEHQAIPDAHAPSAVDWRSAQISSRAEAQQ
MLEKVKQYFAQHEPSHPAPLMIERVQRLIELDFMDIIRDLAPDGVHQLENIFGRRD
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1261206-1262216 Enterobacter aerogenes EA1509E, complete genome
ATGAATATTGATGAATTCCTTGCTCCGGTTAGCGCGGAGCAGCCCTGCGGTGAAAACCTCGAATATGACG
CCGATTTCCAGGCAATGGAACAAGCGATGCAGGGTAAAGCCGAGCAGCAGTTCGGCGACACCATTATCCC
GGCGGAACCCGCTGACTGGACGACGGTAGAAAAGCTGGCGGCTGGGCTACTTAGCCGCACCAAAGATTTA
CGCGTCATGCTGGCGCTGACTCAGGCGTGGACAAAACGCCGCGGCCTGAGTGGTTACGCGGATGGCCTGC
TGCTGGTGCAACAGGCGCTGTCGCTTTACTGGCAGCCTATCTATCCGCTGCTGGAAGAGTATGGCGAAAC
TGATCCGTTTTACCGCATCAATGCGCTCGCGGGGCTAAGCGATAAATCAGCGCTGACCAGCGCGTTACGC
AATGCCGTGCTGTTACGCAGTAATGGCGATGAACTGCTGCTGCGCGATGCGCAGGCGCTGCTCGATGGCA
GTAAAACCGAATGCGCGGATTATCCCGGCGGCCGTTCGCGATTGATTGATGAACTGGCCCGCGGCGGACA
GCCGGGGATAGACGCCATCCTCGCCATTCACCAGCGCTTGCAGACCATCCGCGAAATATTATGCGATTGT
CTGGGTGAAAGCGGCGTGCCGGAAATGGAACAACTGCAGAAGACCGTCGGTATCGTCGCCGGCGCCTGCC
AGATAACCGATATTTCGTCCTTTCACGCGTCCCGCGAGGAGAGTGCCGTGAGTGAACATCAAGCGATTCC
CGACGCGCATGCGCCGTCAGCCGTTGACTGGCGCAGCGCGCAAATCAGCAGCCGCGCCGAGGCGCAGCAA
ATGCTGGAAAAAGTAAAACAGTACTTCGCCCAGCACGAACCGAGTCACCCTGCGCCGCTGATGATTGAAC
GGGTACAGCGGCTGATTGAGCTGGATTTTATGGACATCATCCGCGATTTAGCGCCGGACGGCGTTCATCA
ACTGGAAAACATTTTTGGACGTCGCGACTGA