SecReT6
Protein ID: 444351400
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7054
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1262292..1262816 [+]
ProductUncharacterized protein ImpB
NoteTssB
UniProt IDL8BD11
KEGG IDear:ST548_p7054
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.70E-61, Aligned region: 11..165
Protein Sequence: 174 a.a.     [Download]
>gi|444351400|ref|YP_007387544.1| Uncharacterized protein ImpB [Enterobacter aerogenes EA1509E]
MAISKSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVDNQPAVDERKFLDIDIDNF
DERMKALKPRVAFQVDNTLTNEGKLNVDLTFDSMDDFLPDAVARKVEPLNKLLEARTQLSNLLTYMDGKN
GAEELIAKILQDPTLLKSLSQMPKQDDSAKGSEE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1262292-1262816 Enterobacter aerogenes EA1509E, complete genome
ATGGCAATAAGTAAAAGTGGGCAGAAATTTATCGCACGCAACCGTGCGCCCCGCGTACAGATCGAGTACG
ACGTAGAGATTTATGGTGCGGAACGCAAAATCCAGCTTCCGTTTGTAATGGGGGTAATGGCGGATCTGGT
GGGTAAACCGGTCGACAACCAACCCGCGGTCGATGAACGTAAGTTCCTCGATATCGACATTGATAACTTC
GACGAACGTATGAAAGCGCTGAAACCGCGCGTCGCTTTCCAGGTCGACAATACTCTGACCAACGAAGGCA
AACTGAACGTCGACTTAACCTTCGACAGCATGGACGACTTCCTGCCGGATGCCGTGGCCCGCAAAGTGGA
GCCGCTGAACAAACTGCTGGAAGCCCGTACCCAGCTTTCGAATCTGCTCACCTATATGGACGGCAAAAAC
GGCGCGGAAGAGCTGATTGCCAAAATTTTGCAGGATCCGACGCTGCTCAAATCGTTGAGCCAGATGCCGA
AACAAGATGACAGTGCGAAAGGTAGCGAGGAGTAA