SecReT6
Protein ID: 444351401
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7053
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1262820..1264319 [+]
ProductUncharacterized protein ImpC
NoteTssC
UniProt IDL8BDS2
KEGG IDear:ST548_p7053
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.70E-196, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|444351401|ref|YP_007387545.1| Uncharacterized protein ImpC [Enterobacter aerogenes EA1509E]
MSNPTQQHEQQSSQAFSQDEFSVLLNKEFRPKTDQARSAVESAVKTLAQQALENTVTFSNDTYRTIQNLI
AGIDEQLSRQVNQILHHDEFQKLESAWRGLSYLVNNSETDEMLKIRFMSISKQELGRTLKRYKGVGWDQS
PIFKKIYEQEYGQFGGEPFGCIVGDYYFDHSPQDVELLGEMARIGSAAHCPFITGTAPEVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGADHNNYAWAN
SAYAMAANINRSFKEFGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLIHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDDM
ERWLNDWVMNYVDGDPANSSQETKARKPLAAAEVQVAEIEDNPGYYTAKFFLRPHYQLEGLTVSLRLVSK
LPSLKTKEA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1262820-1264319 Enterobacter aerogenes EA1509E, complete genome
ATGAGCAACCCGACTCAACAACATGAGCAGCAGTCCAGCCAGGCCTTTAGCCAGGATGAATTCAGCGTGC
TGCTGAACAAAGAGTTTCGCCCGAAAACCGACCAGGCGCGTTCCGCCGTTGAGAGCGCGGTAAAAACCCT
CGCGCAGCAGGCGCTGGAAAACACCGTCACGTTTTCCAACGACACCTATCGCACCATCCAGAACCTGATT
GCCGGTATCGACGAGCAACTGTCGCGTCAGGTGAATCAGATCCTGCATCATGACGAGTTCCAGAAACTGG
AAAGCGCATGGCGCGGCCTGAGCTACCTGGTCAACAACAGCGAAACCGACGAGATGCTGAAAATCCGCTT
TATGAGCATCTCCAAGCAGGAGCTGGGGCGCACTCTGAAACGTTACAAAGGGGTGGGCTGGGACCAGAGC
CCGATCTTTAAGAAAATTTATGAGCAGGAGTACGGCCAGTTTGGCGGCGAGCCATTCGGCTGCATCGTTG
GCGATTACTATTTCGACCATAGTCCGCAGGATGTGGAATTACTGGGCGAAATGGCGCGAATCGGATCGGC
TGCGCATTGTCCGTTTATTACCGGTACCGCACCGGAAGTGATGCAGATGGAGTCCTGGCAGGAGCTGGCG
AATCCGCGCGACCTCACCAAAATCTTCCAGAATACCGAATACGCCGCCTGGCGTTCGCTGCGCGAGTCGG
AAGACGCGCGTTATCTGGGGCTGGTGATGCCGCGCTTCCTGTCGCGCCTGCCGTACGGTATTCGAACCAA
CCCGGTGGACAGTTTTGATTTTGAAGAGCAGACCGACGGCGCGGATCACAACAATTATGCGTGGGCCAAC
TCGGCGTATGCGATGGCGGCGAACATTAACCGCTCGTTCAAAGAGTTTGGCTGGTGCACCTCCATTCGCG
GCGTGGAATCCGGCGGCGCGGTGGAAAATCTGCCTTGCCACACCTTCCCGAGCGACGATGGCGGCGTGGA
CATGAAGTGCCCGACCGAGATCGCCATCAGCGATCGCCGCGAAGCGGAGCTGGCGAAAAACGGCTTTATG
CCGCTGATCCATCGCAAAAACTCCGACTTTGCCGCCTTTATCGGCGCGCAGTCGTTGCAGAAACCGGCGG
AATATCATGATGCCGACGCCACGGCTAACGCCCGTCTGGCTGCGCGTCTGCCGTACTTGTTCGCCTGCTG
CCGTTTTGCTCACTACCTGAAGTGCATTGTGCGCGACAAAATCGGCTCCTTCCGCGAGCGCGATGATATG
GAACGCTGGCTGAACGACTGGGTGATGAACTATGTCGATGGCGATCCGGCTAACTCGTCGCAGGAGACCA
AAGCGCGCAAACCGCTGGCGGCCGCTGAAGTACAGGTAGCGGAGATCGAAGACAACCCGGGTTACTACAC
CGCGAAGTTCTTCCTGCGTCCGCACTACCAGCTGGAAGGGCTTACCGTGTCGCTGCGTCTGGTTTCCAAG
CTGCCGTCGCTGAAGACCAAGGAAGCGTAA