SecReT6
Protein ID: 444351407
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7047
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1266554..1268281 [+]
ProductUncharacterized protein ImpI/VasC
NoteFha
UniProt IDL8BFU8
KEGG IDear:ST548_p7047
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.60E-07, Aligned region: 27..94
UreE_N [PF02814], Evalue: 0.0015, Aligned region: 28..49
UreE_N [PF02814], Evalue: 0.0015, Aligned region: 78..99
Protein Sequence: 575 a.a.     [Download]
>gi|444351407|ref|YP_007387551.1| Uncharacterized protein ImpI/VasC [Enterobacter aerogenes EA1509E]
MRFTIISTKAGHQPPQGSCDFYAPGGTIGRGTDNNLVLPDDDRAISRLQAIVHVAADGECKITNRGNVTR
VVLNEIPLERGRQVELQDGDILAIDDYRIEVSDLLQDSQPISRMAASGQPPVTAKPSTPAPSAAATVAEA
APTAVPSEIWDSLMQEFSIADSISSSRAKPQADNAPNPFAEPKPAERNPEDPLAMFADSEPLFERPPVAT
DDLFADDTPFDRDSIFADVTPTTLVPPVEKPAQPVADEPQAELDPLALFGGDASAKTARHDDPLGLMGGA
PLTSVDAFSNEEPAKTVADEPDAAFDSPLLMAQPPQEPPAAAREEAPEITLPTPQAVARQAAQTPKGRLR
IDPVRHEHQATSTPQPGNGEVLQGELLEALLEGMGLGDMQPVPQFDKENMRQLGQMLSMFSQGTVALLSS
RSILKRGVKADMTMVLDDANNPFKLLPSGKTVLMQMFGARMPGFMPPKKSVRDALIDLQAHQLGMISGIR
AIIAAMLQSFNPEQLEEEAKRDGHTSRLALPASRKAALWDYFVRTYGETAGQIEDDFHTLFGEAFLYAYD
MEVNQYKDSQSGSEE
 
Nucleotide Sequence: 1728 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1266554-1268281 Enterobacter aerogenes EA1509E, complete genome
ATGCGATTCACGATTATTTCGACCAAAGCCGGTCATCAGCCCCCGCAGGGCAGCTGTGACTTTTACGCGC
CGGGCGGTACCATTGGGCGCGGTACGGACAATAACCTGGTGCTGCCGGATGACGACCGCGCCATTTCTCG
CCTCCAGGCCATCGTTCACGTGGCGGCAGACGGCGAGTGCAAAATTACCAATCGCGGCAACGTGACGCGG
GTGGTACTCAACGAGATCCCGCTGGAGCGGGGGCGTCAGGTTGAACTCCAGGATGGCGATATCCTCGCCA
TTGACGACTATCGCATCGAAGTCAGCGATCTGCTGCAGGATAGCCAACCGATAAGCCGAATGGCGGCGAG
CGGTCAGCCGCCTGTCACTGCGAAACCGTCGACACCAGCTCCATCCGCAGCGGCCACCGTGGCGGAAGCC
GCGCCAACCGCGGTACCGTCAGAAATCTGGGATAGCCTGATGCAGGAATTCTCGATTGCCGACAGCATCT
CCAGCAGCCGGGCTAAGCCGCAGGCCGATAATGCGCCTAATCCCTTCGCCGAGCCGAAGCCTGCCGAACG
TAATCCGGAAGATCCGCTGGCGATGTTCGCTGATAGTGAACCTCTGTTTGAGCGCCCGCCGGTGGCGACG
GACGACCTGTTTGCCGATGACACCCCATTTGATCGCGACAGTATTTTTGCCGACGTTACGCCAACGACGC
TGGTGCCGCCAGTTGAAAAACCGGCTCAGCCTGTCGCCGATGAGCCGCAGGCAGAATTGGATCCGCTGGC
GCTCTTTGGCGGCGACGCCAGCGCCAAAACCGCGCGTCATGACGATCCGCTGGGGCTAATGGGCGGCGCG
CCGCTGACATCGGTAGATGCCTTCAGCAACGAAGAGCCTGCTAAAACGGTTGCCGACGAGCCTGATGCCG
CTTTTGATTCGCCATTATTGATGGCCCAGCCGCCGCAGGAGCCGCCCGCGGCAGCGCGCGAAGAAGCGCC
GGAAATAACCTTACCGACGCCGCAGGCCGTGGCGCGGCAAGCCGCCCAAACGCCAAAAGGGCGCTTGCGT
ATCGATCCCGTACGTCATGAACATCAGGCGACCAGCACGCCGCAGCCGGGTAACGGCGAAGTGCTGCAGG
GAGAGCTACTGGAAGCCTTACTGGAAGGCATGGGGCTCGGCGATATGCAGCCGGTCCCGCAGTTCGACAA
AGAGAATATGCGACAGCTTGGCCAAATGCTGAGCATGTTCTCGCAGGGAACCGTCGCGCTGCTCTCTTCG
CGTTCGATCCTCAAACGCGGCGTCAAAGCCGATATGACCATGGTACTGGACGACGCCAATAACCCGTTCA
AGCTGTTGCCTTCCGGGAAAACCGTGCTGATGCAGATGTTCGGCGCGCGGATGCCGGGCTTTATGCCGCC
GAAAAAATCGGTACGCGATGCGTTGATTGACCTGCAGGCCCATCAGTTAGGGATGATCTCGGGGATCCGC
GCCATTATTGCCGCGATGCTGCAGTCCTTTAATCCCGAGCAGCTGGAAGAAGAGGCTAAGCGCGATGGCC
ATACCTCGCGCCTGGCGCTTCCGGCCAGCCGCAAAGCGGCGTTATGGGACTATTTTGTCCGTACCTACGG
CGAAACCGCCGGGCAAATTGAAGACGATTTCCACACCCTGTTTGGCGAAGCGTTCCTCTATGCCTATGAC
ATGGAAGTGAACCAGTACAAAGACTCACAGAGCGGATCGGAAGAATAA