SecReT6
Protein ID: 444351410
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7044
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1270090..1270884 [+]
ProductProtein of avirulence locus ImpE
NoteTagJ
UniProt IDL8BD19
KEGG IDear:ST548_p7044
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.80E-42, Aligned region: 141..263
TPR_19 [PF14559], Evalue: 0.00039, Aligned region: 13..68
TPR_19 [PF14559], Evalue: 0.00039, Aligned region: 215..225
Protein Sequence: 264 a.a.     [Download]
>gi|444351410|ref|YP_007387554.1| Protein of avirulence locus ImpE [Enterobacter aerogenes EA1509E]
MNTLYQQLAGESVGAALQRLESEIKSRPADADLRAAFVQFLCLSGNWTRALAQLKSWLALKPQAQPTVTL
LEQSIQGEQQRDAVFAGSARPQMPDSQWPWLSALASALCSDSETAQRQRLAAFEQAPLNPGNLNQTDTPA
VAFHWLMDGDARLGPVCELIVNGRYCWLPFAAIAEIRFQAPASVTDLVWRHALVRLTDGSEQVCQIPARY
PVTPQAEARFQLGRATEWQPLDDEGALYQGHGQKVWLNDNDEFPILSLDVVSFA
 
Nucleotide Sequence: 795 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1270090-1270884 Enterobacter aerogenes EA1509E, complete genome
ATGAACACGCTATATCAACAGCTGGCTGGCGAAAGCGTCGGCGCGGCGCTGCAACGCCTGGAAAGCGAGA
TCAAAAGCCGTCCCGCCGATGCCGATTTACGTGCGGCGTTCGTTCAGTTTCTATGCCTGAGCGGTAACTG
GACGCGCGCGTTGGCGCAGCTAAAAAGCTGGCTGGCGCTGAAGCCGCAGGCCCAGCCAACGGTCACCCTG
CTGGAACAGAGCATTCAGGGCGAGCAGCAGCGCGATGCGGTATTTGCCGGTAGCGCCCGCCCGCAGATGC
CGGACAGCCAGTGGCCGTGGCTGTCTGCGCTGGCCTCCGCGCTTTGTTCCGATTCAGAAACCGCCCAGCG
ACAGCGGCTGGCCGCCTTTGAACAGGCGCCCCTTAATCCTGGTAATCTCAATCAGACGGATACCCCCGCG
GTCGCTTTTCACTGGTTGATGGACGGCGACGCGCGTCTGGGCCCGGTTTGCGAACTTATCGTCAATGGCC
GGTATTGCTGGCTGCCGTTCGCCGCTATCGCCGAAATTCGTTTTCAGGCCCCGGCGAGCGTCACCGATCT
GGTGTGGCGCCATGCGCTGGTGCGCCTGACCGATGGAAGCGAGCAGGTGTGTCAGATCCCCGCGCGTTAC
CCTGTCACGCCGCAGGCGGAAGCACGCTTCCAGTTAGGCCGCGCCACCGAGTGGCAGCCGCTGGACGACG
AAGGCGCGCTGTATCAGGGCCACGGGCAGAAAGTGTGGCTTAACGATAACGATGAATTCCCGATTCTCTC
TCTCGACGTGGTGAGTTTTGCATGA