SecReT6
Protein ID: 444351411
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7043
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1270881..1271444 [+]
ProductUncharacterized protein ImpF
NoteTssE
UniProt IDL8BDS7
KEGG IDear:ST548_p7043
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.00E-19, Aligned region: 56..166
Protein Sequence: 187 a.a.     [Download]
>gi|444351411|ref|YP_007387555.1| Uncharacterized protein ImpF [Enterobacter aerogenes EA1509E]
MNKPVRDGDALRSGWQARSKQETIGARDKMQPSLLDRLTDNQPQKKSEPLNSNLITHSTLRRHVLRDLQW
LFNTINHDDPQALDALAHVRRSVVNFGVAPLAGKRMSDIEWQDIQRKLTEAIISFEPRILPQGLQVRCIS
DTQSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFELKDAG
 
Nucleotide Sequence: 564 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1270881-1271444 Enterobacter aerogenes EA1509E, complete genome
ATGAACAAACCGGTACGCGACGGTGACGCGCTGCGCAGCGGCTGGCAGGCGCGTAGCAAACAAGAGACCA
TTGGTGCCCGCGATAAGATGCAGCCGTCGCTGCTCGACCGCCTGACCGATAATCAGCCGCAGAAAAAATC
GGAGCCGCTTAACAGCAACCTGATCACCCACAGTACGCTGCGCCGTCACGTGCTGCGCGATCTGCAGTGG
CTGTTTAATACCATCAATCATGACGATCCGCAGGCGTTGGACGCGCTGGCGCACGTGCGCCGTTCGGTGG
TTAATTTCGGCGTCGCGCCGCTGGCCGGGAAACGGATGTCGGATATTGAGTGGCAGGATATTCAGCGCAA
ACTTACCGAGGCGATTATCAGCTTCGAACCGCGCATTCTGCCGCAGGGGCTGCAGGTCCGCTGTATTTCT
GATACCCAGTCACTGGATTTACATAATGTCCTGTCGATTGAAATTAAAGGGCGGCTGTGGTGCGTACCGT
ATCCATTAGAGTTTCTGTTCCGTACCGATGTGGATCTCGAAAATGGCCACTTTGAATTGAAAGACGCGGG
GTAA