SecReT6
Protein ID: 444351412
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7042
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1271447..1273318 [+]
ProductProtein ImpG/VasA
NoteTssF
UniProt IDL8BFV3
KEGG IDear:ST548_p7042
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.20E-212, Aligned region: 5..623
Protein Sequence: 623 a.a.     [Download]
>gi|444351412|ref|YP_007387556.1| Protein ImpG/VasA [Enterobacter aerogenes EA1509E]
MEGKLLEYYNRELAYLREMGAEFAERYPKVAGRLGMRGIEVADPYVERMMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMIAPNYLAPTPSMAIAELQPDINKGDLSKGFVVPRGTMMDSQVLKKNGVTCSYTTAHDVTLLP
LRIEKAELGGIPADVPLAALGLSQRGAVSALRLRISCEGAQHLGHLTFDRLAFFLSGPDIEALRLLELIL
AHQVGVVCQTTGRDPLRFSLSEEAIQQEGFAAKQALLPEDLRNFDGYRLLHEYFAFPARFRFISINGLSK
LIGQCKEEKSFDIIILLDKTDDRLEQVVEANHFALHCTPVINLFPKIAARQSLSDSQHEYHLVVDNIRPL
DYEIYSVSKIHGSADGHRDDREFRPFWSSWSKDAGDYGAYFSLRREQRVLSEHALRYGTRTGYTGSETFV
SLVDEQHAPWQEDLRYITAEVLCTSRDLPLMLQQELGQFVLADSLPVKTLKMRSGPTPPRPALAEGLSTW
RLISQLQMNYLSLMDGENGEGAAALRQLLGLYAGLAETAVARQIEGVRHCVLEPVHRRVPEPGPIVFARG
IGITLTVDERAFSGASPWLFGSVLERVFARLVSLNSFTEFTLCSQQRGEIGYWAPRMGKRALI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1271447-1273318 Enterobacter aerogenes EA1509E, complete genome
ATGGAAGGCAAACTGCTTGAATATTACAACCGCGAGCTGGCCTATCTGCGTGAGATGGGCGCTGAATTCG
CCGAACGCTATCCGAAGGTTGCCGGCAGGTTGGGCATGCGCGGTATTGAGGTCGCCGATCCTTACGTTGA
GCGGATGATGGAGGGGTTCGCCTTTCTGACTTCCCGCGTGCAGCTAAAAATGGACGCCGAATTCCCGCGT
TTTTCACAGCGCCTGCTGGAGATGATCGCGCCCAATTATCTGGCGCCTACGCCGTCGATGGCGATTGCCG
AACTGCAGCCGGACATCAATAAAGGCGATCTGAGTAAAGGTTTCGTGGTGCCGCGCGGTACGATGATGGA
CAGCCAGGTACTGAAGAAAAACGGCGTCACCTGTAGCTATACCACCGCGCACGATGTCACGCTGTTGCCG
CTGCGTATTGAGAAAGCCGAACTTGGCGGGATCCCCGCCGATGTGCCGCTGGCCGCGCTTGGGCTCAGCC
AGCGCGGCGCCGTCAGCGCTTTGCGCCTGCGTATAAGCTGTGAAGGGGCTCAACATCTTGGTCATCTGAC
CTTTGACCGGCTGGCGTTTTTCTTAAGCGGCCCGGATATTGAGGCGCTGCGCCTGCTGGAGCTGATTCTT
GCCCACCAGGTCGGCGTGGTGTGCCAGACCACCGGGCGCGATCCGCTGCGTTTTTCGCTGAGCGAAGAGG
CTATACAACAAGAGGGTTTCGCCGCCAAACAGGCGCTGCTACCGGAAGATCTTCGCAATTTTGACGGCTA
CCGGTTGCTGCACGAATACTTTGCCTTCCCGGCGCGCTTCCGCTTTATCAGTATTAACGGCCTCAGCAAG
TTAATCGGCCAGTGCAAGGAAGAAAAATCCTTCGATATCATTATCCTGCTGGATAAAACAGACGACCGGC
TGGAACAAGTGGTGGAAGCTAACCACTTCGCGTTGCACTGCACGCCGGTGATTAACCTGTTTCCGAAAAT
CGCCGCCCGCCAGTCGCTGAGCGACAGCCAACATGAATACCATCTGGTGGTCGATAACATCCGCCCGCTG
GACTACGAAATCTATTCGGTGAGTAAAATTCACGGCAGCGCCGATGGCCACCGCGACGATCGCGAGTTCC
GTCCATTCTGGAGTTCATGGAGCAAAGATGCCGGAGATTACGGCGCTTATTTTTCACTGCGCCGCGAACA
GCGGGTGCTTTCCGAACACGCGCTGCGCTATGGCACGCGTACCGGCTATACCGGCTCTGAGACCTTTGTC
TCACTGGTCGATGAGCAGCATGCGCCGTGGCAAGAAGATCTGCGTTACATCACCGCCGAGGTGCTGTGCA
CCAGCCGCGACCTACCGTTGATGCTACAACAGGAGCTGGGGCAATTCGTGCTGGCGGATTCGCTACCGGT
AAAAACATTGAAAATGCGTAGCGGCCCGACGCCGCCGCGACCGGCGCTGGCGGAAGGGCTCAGCACCTGG
CGGCTGATAAGCCAGCTGCAGATGAACTATCTCAGCCTGATGGACGGTGAAAATGGCGAAGGCGCAGCAG
CGCTGCGCCAGTTGCTTGGGCTGTATGCCGGGCTGGCGGAGACCGCCGTGGCCCGCCAAATCGAAGGGGT
ACGCCACTGCGTGCTGGAGCCAGTTCATCGCCGGGTGCCGGAGCCGGGGCCGATCGTCTTCGCCCGCGGT
ATCGGCATTACCTTAACCGTTGACGAGCGCGCTTTTTCCGGCGCCAGCCCGTGGCTGTTTGGTAGCGTAC
TGGAACGGGTCTTTGCCCGGCTGGTGTCGCTCAACAGCTTTACCGAATTCACCTTATGTAGCCAGCAGCG
CGGCGAAATCGGTTACTGGGCGCCGCGAATGGGGAAAAGGGCGCTGATATGA