SecReT6
Protein ID: 444351413
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7041
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1273315..1274358 [+]
ProductUncharacterized protein ImpH/VasB
NoteTssG
UniProt IDL8BGV2
KEGG IDear:ST548_p7041
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.70E-106, Aligned region: 24..328
Protein Sequence: 347 a.a.     [Download]
>gi|444351413|ref|YP_007387557.1| Uncharacterized protein ImpH/VasB [Enterobacter aerogenes EA1509E]
MSDTLATIHRLTPLADVFWREVTAAPWRYDLFHLLRRIDAQGGERYPLGRAPLPKFESLRIGQTPSMGFA
PATLASAQKRENSAVHEISILSFGLFGPNGPLPVHMTEYARERIHHHQDDSLSAFADLFHHRLTLLFYRA
WADAQPTVSLDRADNRRFERYLASLIGMGQPGQLEKGDLSPHARFTHAGHLSRHGRDPEGLEKILRNYFK
VPVNIISNVPQWMPLTSREQAQLGAGRRLPRLGVSAFLGVAVRDVQHKFRLEIGPLSAAEYARFLPGENA
VNELRDWIRQYLGIEYAWDVRVLIRGDEIPGTVLSGDGKLGYSTWLGHQPAPAPRGDLVFSVEQSDA
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1273315-1274358 Enterobacter aerogenes EA1509E, complete genome
ATGAGTGACACGTTGGCTACCATTCATCGCCTGACGCCGCTGGCGGACGTTTTCTGGCGCGAGGTTACCG
CCGCGCCCTGGCGCTACGACCTTTTTCATCTGCTGCGCCGCATTGACGCGCAAGGGGGCGAACGTTATCC
GCTTGGGCGCGCGCCGCTGCCGAAATTCGAATCGCTGCGCATCGGGCAAACGCCATCAATGGGGTTTGCG
CCCGCGACGCTGGCCAGCGCGCAGAAACGGGAAAATAGCGCGGTGCATGAGATATCGATTCTCAGCTTCG
GTCTGTTCGGCCCCAATGGCCCGCTGCCGGTTCATATGACCGAATACGCCCGTGAGCGTATTCATCATCA
TCAGGACGACAGCCTGAGCGCTTTTGCCGATCTCTTTCATCACCGCCTGACGCTGCTGTTCTACCGCGCC
TGGGCTGACGCGCAGCCAACGGTATCGTTAGACCGTGCGGACAACCGCCGCTTTGAGCGCTATCTCGCCT
CACTCATCGGCATGGGCCAGCCGGGGCAACTGGAGAAGGGCGACCTGAGCCCGCATGCGCGTTTCACCCA
CGCAGGCCATCTCAGCCGCCATGGTCGGGATCCGGAAGGACTGGAGAAGATCCTGCGAAATTACTTCAAA
GTCCCGGTCAACATTATCAGCAACGTGCCGCAATGGATGCCGCTGACCTCGCGAGAACAAGCGCAACTGG
GGGCGGGAAGGCGTTTACCTCGCCTGGGCGTCTCGGCGTTTCTCGGCGTCGCGGTACGCGATGTTCAGCA
TAAATTCCGCCTTGAAATCGGCCCGCTTAGCGCCGCCGAATACGCCCGTTTTCTGCCGGGCGAAAACGCG
GTAAACGAATTACGCGACTGGATCCGCCAGTATCTTGGGATTGAATATGCATGGGATGTCAGGGTACTTA
TCCGCGGCGATGAAATACCCGGTACGGTCCTCAGCGGCGACGGCAAACTGGGTTACAGCACCTGGCTTGG
CCACCAGCCAGCCCCCGCGCCGCGTGGCGATTTAGTGTTTAGCGTGGAGCAGAGCGACGCTTGA