SecReT6
Protein ID: 444351418
SecReT6 ID727
T6SS typei3
Gene symbol-
Locus tagST548_p7036
StrainEnterobacter aerogenes EA1509E
Repliconchromosome [GenBank: NC_020181] [Browse all T6SS(s) in this replicon]
Location [Strand]1279347..1281590 [+]
ProductVgrG protein
NoteTssI
UniProt IDL8BGV7
KEGG IDear:ST548_p7036
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-72, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 3.20E-25, Aligned region: 365..458
Protein Sequence: 747 a.a.     [Download]
>gi|444351418|ref|YP_007387562.1| VgrG protein [Enterobacter aerogenes EA1509E]
MSNRITVQLPVEGLLFWKLSGHEAMSEMFELSLTLLGSDARLDRSKLLGQPVTVTIPTQNALSSRYFNGK
ITRVAVSAVELSGIRYAAYQLTVEPDLWPMKRDRNLRIFQGQTVPQIINTLLSEYQVNVEDKLNGSYRVW
DYCVQYQESSFAFISRLMELEGIAYHFRHEAGKHTMVLTDSATQHQPVSGYETIPYHQTASGGITTEEGI
GQWALEDSVTPGIYSLDDYDFRKPNAWLFQARQNPASPSPGSIDVYDWPGRFVDHGHGEFYARIRQERWQ
VEHQQIQASATAVGIAPGATFTLTNAPFFSDNGEYLTTAADYLFEENSYASGGNSDISHQIHFRVIPSSV
VYRPAQVTDWPRTYGPQTAKVVGPEGESIWTDRYGRIKVKFHWDRHAKGDDTSSCWVRVSSAWAGQGFGG
VQIPRVGDEVVIDFINGDPDRPIVTGRVYNEASMPPWDLPGDATRMGFMTRSKDGNIDNSSFLFFEDNPG
NESVEMHSEKDMKISVENDKYVTIDGSRSTVISKDQSDDVTGKAIFNYHNLRTTTVDMKETEIFKNGQKV
EITNGREFEIKSGGDDMKIKGNRKTTITGDEEHHVTGVITQNFDNGLITNINKGGKSEVITDGGLSVHVD
GGDWVQKVQNGKIDISSPNAVHIKSDSSVTIDAPTQLVTAKGYNIAFTGISISGTGKSISMNAVSTSING
ASFSWTPLSISTSLASVVHAPMNYQRSLTKIEDSIQNLAIGVIHMFI
 
Nucleotide Sequence: 2244 bp     [Download]
>gi|444350194|ref|NC_020181.1|:1279347-1281590 Enterobacter aerogenes EA1509E, complete genome
ATGTCTAACAGGATCACCGTTCAGCTCCCCGTTGAGGGGCTGCTTTTCTGGAAACTCAGCGGACATGAAG
CCATGTCGGAAATGTTCGAGCTCAGCTTAACGCTGCTTGGCAGCGATGCGCGTCTGGATCGCAGCAAGCT
GCTTGGCCAGCCGGTCACCGTGACCATTCCGACGCAAAACGCGCTGAGTTCGCGTTATTTCAACGGTAAA
ATTACCCGCGTGGCGGTGAGCGCCGTTGAACTGAGCGGTATCCGCTACGCCGCTTACCAACTGACCGTTG
AACCCGACTTATGGCCGATGAAACGCGACCGCAACCTGCGTATATTCCAGGGGCAGACGGTACCGCAGAT
CATCAATACGTTGCTGAGTGAATACCAGGTCAACGTTGAGGATAAGCTGAACGGCAGTTACCGCGTCTGG
GATTACTGCGTCCAGTATCAGGAAAGTAGTTTCGCCTTTATCAGCCGCCTGATGGAGCTGGAGGGGATTG
CCTACCATTTCCGCCACGAGGCGGGTAAACATACGATGGTTCTGACCGATTCAGCCACCCAGCATCAACC
GGTAAGCGGCTATGAAACCATTCCCTACCACCAGACGGCATCGGGCGGTATTACCACTGAAGAGGGGATC
GGTCAGTGGGCGCTGGAAGATAGCGTGACGCCGGGGATTTACAGCCTCGATGACTATGATTTCCGTAAAC
CTAACGCCTGGCTGTTTCAGGCGCGGCAGAACCCGGCATCGCCCTCGCCGGGCAGTATCGACGTGTACGA
CTGGCCGGGGCGGTTTGTCGATCACGGACACGGTGAATTCTACGCCCGTATCCGCCAGGAGCGCTGGCAG
GTAGAACATCAGCAGATCCAGGCGTCCGCCACCGCGGTAGGCATCGCTCCCGGCGCAACGTTTACCCTAA
CCAATGCGCCATTCTTTAGCGATAACGGCGAATATTTGACGACCGCCGCAGATTACTTGTTTGAAGAGAA
CAGCTACGCCAGCGGCGGCAATAGCGATATCTCGCACCAAATCCATTTTAGAGTGATCCCCTCTTCGGTG
GTCTATCGCCCGGCGCAGGTAACCGACTGGCCGCGAACCTATGGCCCGCAGACGGCGAAAGTTGTCGGGC
CTGAAGGGGAAAGCATCTGGACCGACAGGTATGGCCGCATCAAAGTGAAGTTTCACTGGGACCGCCACGC
CAAAGGCGATGACACCAGCTCCTGCTGGGTTCGCGTGTCGAGCGCCTGGGCAGGCCAGGGCTTTGGCGGC
GTGCAAATTCCCCGCGTCGGCGATGAAGTGGTCATTGATTTTATCAACGGCGATCCTGACCGCCCGATCG
TCACCGGACGTGTGTATAATGAAGCCAGCATGCCGCCTTGGGATCTCCCCGGCGACGCCACCCGGATGGG
CTTTATGACGCGGAGTAAGGATGGGAATATTGATAACAGCAGTTTCTTGTTCTTCGAAGATAATCCGGGC
AATGAATCCGTCGAGATGCATTCAGAGAAAGATATGAAGATCTCGGTAGAGAATGATAAATATGTAACTA
TTGATGGTTCCCGTAGCACTGTCATTTCAAAGGACCAGAGTGATGATGTTACAGGTAAGGCAATTTTTAA
CTATCATAATTTACGAACTACCACTGTTGATATGAAGGAAACAGAAATATTTAAAAATGGGCAAAAAGTA
GAAATTACCAATGGACGCGAGTTTGAAATAAAAAGTGGCGGCGATGATATGAAAATCAAAGGGAATCGAA
AAACCACTATTACTGGCGATGAAGAACACCATGTAACAGGAGTGATAACTCAGAACTTTGATAATGGATT
AATAACAAATATTAATAAAGGTGGGAAATCTGAAGTCATTACCGATGGTGGACTCTCCGTGCATGTGGAT
GGTGGTGACTGGGTGCAAAAGGTACAAAATGGCAAAATAGATATTTCGTCACCAAATGCAGTTCATATTA
AAAGCGATTCATCAGTAACTATTGATGCGCCAACTCAATTGGTTACTGCAAAAGGTTATAATATTGCGTT
TACAGGTATTTCTATTTCAGGTACAGGGAAAAGTATATCGATGAATGCTGTTAGTACATCAATTAATGGA
GCAAGTTTCAGTTGGACCCCACTTAGTATATCCACATCTTTAGCAAGTGTCGTTCATGCGCCGATGAACT
ATCAGCGTTCATTAACAAAGATAGAAGATTCTATCCAAAACCTTGCAATTGGCGTAATCCATATGTTTAT
TTAA