SecReT6
Protein ID: 445953536
SecReT6 ID790
T6SS typei1
Gene symbol-
Locus tagVCV52_A0124
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]36181..36687 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-58, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|445953536|ref|WP_000031391.1| type VI secretion protein [Vibrio cholerae V52]
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKNNFEAVMRESE
LKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELREALVALKGPLGNIPAFRERL
QSLLNSEESREKLLAELNLLSGQEEPQA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0124|:36181-36687
ATGTCTAAAGAAGGAAGTGTAGCTCCCAAAGAGCGGATTAATATCAAGTATATTCCGGCGACGGGGGATG
CACAGGCTGAGGTTGAGCTACCACTCAAAACCCTAGTTGTAGGTGATTTCAAAGGGCATGCGGAGCAAAC
CCCATTGGAAGAGCGTGCAACAGTCACGGTAGATAAGAACAACTTTGAAGCCGTAATGCGCGAGAGCGAG
CTGAAAATCACCGCCACGGTGAAAAACAAGCTGACTGATGATGAGAATGCCGAGCTTCCTGTTGAACTCA
ATTTCAAATCCTTAGCCGACTTCGCTCCTGATGCGGTGGCATCACAAGTTCCAGAACTGAAAAAATTGAT
TGAGTTGCGTGAAGCGTTAGTTGCCCTTAAAGGGCCGCTAGGCAACATTCCCGCATTTCGTGAGCGTTTA
CAGTCATTACTCAACTCAGAAGAGTCGAGAGAAAAACTGTTGGCAGAACTGAATCTGCTCAGTGGTCAAG
AAGAGCCACAAGCGTAA