SecReT6
Protein ID: 446005552
SecReT6 ID790
T6SS typei1
Gene symbol-
Locus tagVCV52_A0132
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]27379..28152 [-]
Producthypothetical protein
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-69, Aligned region: 37..242
Protein Sequence: 257 a.a.     [Download]
>gi|446005552|ref|WP_000083407.1| hypothetical protein [Vibrio cholerae V52]
MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECDNIEQIYRQTI
EEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILS
RLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREKVISRLHQLLSSLEESEPQDLTRPTDHVVRA
KYTLSRQMPVWSVFAGFIVLWIGLFLGYSYVLHSKSSDVLNQLNQIL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0132|:27379-28152
ATGTCACAGAGTAAAAAAGAGACGCCATTAGCCAGTTTGTTGTTCGACGATGTGGAAAAAATTAACCACG
ACCAAGACTACTGGTTCCAATTGCGTGGGGACAATCCAAATGTGCTGATTGATGCCGCGACACCCTTGTT
TGGGCTTTCTCTGCGGGTTCGCACCCTCACTGAATGCGACAACATTGAACAGATCTACCGTCAGACGATT
GAAGAGATCAAAGCGATTGAAATTGAGTTGACGGAGCAAGGTTACGAACACGCCATTTTGATGGCCTATC
GCTACATCTTGTGCGCCTTTTTGGATGAATCCGTGATGGGAACCGAGTGGGGCGCGTCCAGTTTATGGGC
CGAGCACTCCATGCTGTCACGTTTCCATAATGAAACGTGGGGCGGTGAGAAAGTGTTTACGATTTTGAGC
CGTCTTGAGGGTGAACCACACCGTTACCAAGCGCTATTGGCCTTTATTTATCACTGCCTGATTTTGGGCT
TTGAAGGCAAATACCGTGTGATGGAAGGGGGACAAGCTGAGCGCGAAAAAGTGATCAGCCGCCTGCATCA
ACTGCTGAGCAGCTTGGAAGAGAGCGAGCCACAAGACTTAACCCGTCCGACCGATCATGTGGTGCGTGCG
AAATATACCCTAAGCAGACAGATGCCTGTTTGGTCTGTGTTTGCTGGCTTTATCGTGCTTTGGATAGGTC
TATTTCTCGGCTACAGCTATGTGCTGCATAGCAAATCCAGCGATGTGCTCAATCAACTCAATCAAATACT
TTAA