SecReT6
Protein ID: 446035450
SecReT6 ID790
T6SS typei1
Gene symbolvgrG-3
Locus tagVCV52_A0139
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]12911..15964 [-]
Producttype VI secretion protein VgrG
NoteTssI
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.30E-60, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 7.80E-25, Aligned region: 374..467
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 536..549
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 731..773
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 787..799
DUF2345 [PF10106], Evalue: 5.20E-05, Aligned region: 570..619
PG_binding_3 [PF09374], Evalue: 0.00087, Aligned region: 734..767
PG_binding_3 [PF09374], Evalue: 0.00087, Aligned region: 785..802
Protein Sequence: 1017 a.a.     [Download]
>gi|446035450|ref|WP_000113305.1| type VI secretion protein VgrG [Vibrio cholerae V52]
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRSEPCYGFRYQVDLASALSNLTAEQFVDQTAHLTIL
RDGQVVQQINGIVRQFSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEDYA
FALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSYLHEAQKHTLLFTDSSDSQPKLAKPVPYNALAGG
EINLPYVVDLQFKTTAQVSHTELKDYSFKKPAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFS
QIRLEYLRRDALLADAKSDEPLLLAGVRFDLQDHLDLAMNRDWLVVQANHQGTQPQALQEEGGAGATTYS
NQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTETHQGQGYNEL
SFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHE
VGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGS
GSAYGGQLAAAPRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPE
RILKSDLLKPSDELEKLAKRQASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQK
SYQPSHQTHPSYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGN
GDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFREEQHQFIKRTH
YDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNMESMTDKDIIILVQDYKLVNTE
RLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK
 
Nucleotide Sequence: 3054 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0139|vgrG-3|:12911-15964
ATGGCAAGGTTACAGTTTCAATTAAAGGTGGATGGCCTTGAGGATGAATCCCTCGTCGTACGCGGATTTG
AAGGGCAAGAGTCCTTGTCTGATTCTGTATGGCGCAGTGAACCCTGCTATGGTTTTCGCTATCAGGTTGA
TTTAGCCAGTGCGCTAAGTAATCTCACGGCTGAGCAATTTGTAGACCAAACCGCACATTTAACCATTCTG
CGTGACGGGCAAGTGGTGCAGCAAATAAACGGTATTGTGCGTCAATTCAGCAAAGGGGATACCGGCCATC
GACATACTTTCTATTCATTAACGCTAGTTCCTGCGTTGGAAAGGCTTTCTTTACGCAGTAATAGCCGTAT
TTTCCAGCAGCAAAGCGTGCCAGAGATTATCTCTATTTTACTGCAAGAGATGGGGATTGAAGATTACGCC
TTTGCCCTTAAGCGTGAGTGTGCCCAGCGAGAGTTTTGTGTACAGTATCGTGAAACAGATTTGCAGTTTT
TACACCGTATCGCCGCCGAAGAAGGTTTGGTTTACAGCTATCTACATGAAGCGCAGAAACACACCTTGCT
GTTTACCGATAGCTCGGACAGCCAACCGAAGTTAGCCAAGCCAGTACCTTATAATGCGCTGGCGGGTGGC
GAGATCAATCTCCCTTATGTGGTCGATCTGCAATTCAAGACCACCGCGCAAGTGAGCCATACCGAGCTAA
AGGATTACAGCTTTAAAAAGCCAGCTTACGGATTTACTCAGCGCACGCAGGGTAAAGATATCGCTTATCA
GCAGCCAAATTATGAGCATTTTGATGCTCCGGGACGCTACAAAGACGATGCAAATGGCAAGGCCTTTAGC
CAAATTCGCTTAGAGTATTTACGCCGCGATGCTTTGCTTGCTGATGCGAAGAGTGACGAACCTTTGCTGT
TGGCGGGAGTGCGTTTTGACTTGCAAGATCACCTTGATCTCGCAATGAATCGAGATTGGCTCGTGGTACA
AGCCAATCACCAAGGGACGCAGCCACAAGCGTTACAAGAAGAGGGGGGGGCAGGCGCTACCACTTACAGC
AATCAGCTAAAACTTATCCCCGCTCACATCACTTGGCGAGCAAGGCCTTGTGCTAAGCCGCAAGTGGATG
GTCCCATGATCGCTACCGTAGTTGGGCCACAAGGTGAAGAGATTTATTGTGATAACTTTGGTCGCGTGAA
AGTGCATTTCCCGTGGGATCGCTACTCAAGTAGCAATGAGAAAAGCTCTTGCTGGGTACGAGTGGCACAA
GAATGGGCGGGTAGCCAATACGGTAGTATGGCGATTCCGCGAGTCGGCCATGAAGTGATTGTTTCGTTCC
TGAATGGCGATCCGGATCAACCCATCATCACGGGTCGTACGTACCATGCGACCAATACCGCGCCTTACGC
CTTGCCTGACCACAAAACCAAAACCGTACTGCGAACTGAGACTCACCAAGGGCAAGGCTACAACGAACTG
AGTTTTGAGGATCAAGCGGGCAGCGAACAGATTTTGCTGCATGCACAAAAAGATTGGGATGCGTTGATTG
AGCATGATCACACCGAAGTGATTCGCCACGATCAGCATCTCACTGTGGACAATGATCGCTTTACCCGCAT
TCAGCGCAACCAACATTTAACGGTTGAAGGTGAAGTCCGTAGCAAAATCGCACTCGATAGCAGCCATGAA
GTCGGCGCGTCACTACAACACAAAGTAGGGCAACGCATTGCTGTCGAGGCGGGCAAAGAGATTTCACTCA
AAAGCGGCGCAAAAATCGTGGTTGAAGCCGGAGCGGAGTTAACCCTAAAAGCAGGGGGCAGCTTTGTAAA
AGTCGATGCAGGTGGCGTGCACTTAGTCGGTCCTGCCATTAACCTAAACGCGGGCGGCAGTGCAGGCAGC
GGTAGCGCTTATGGTGGGCAATTAGCCGCAGCACCAAGAATGTTAGCGCAAGCTAAACCAGTAGCTGAAT
TGGTTCAGCCGGATATTGCTGCCTCAATGCAATCAGGCGCGGCGCGTGTTATTGATGTGGCATCACTCCC
CACAATGATGCCGAGTTCAGCCAATAACACGGCAAATGATGAGCCTGTGGCCGAAGAGAAAACACCGGAG
CGAATTTTAAAATCCGATCTCCTCAAACCATCCGATGAGTTAGAGAAACTCGCCAAGCGACAAGCGAGTG
CTTATCGTCAAGGTAATCACAGCGATGAGGTTAAGTTACTACAAGAAGCGCTCATAAAATTGGGGTTTGA
TCTCGGGAAAGCAGGAGCTGATGGTGACTTTGGGAGCAAAACTAAAACCGCGATTGAGCAGTTCCAGAAA
AGCTATCAACCAAGCCACCAAACCCACCCGTCTTACAGCATTGGCGCTGTTGACGGTATTGTCGGCAAAG
GTACACTACTGGCACTAGACGAAGCCTTGATGGATGGGTGGGTGTATGAGAATAATATTTATCAAATATG
GCCTCTAGGTAAAACGTCAGAGAAATATGAGTCGGCAGGAAGAGGCCCAGGGGTTATATCAACAGGAAAT
GGAGATTATGGTGGGGCTTCATATGGTTGCTATCAAATGTCATCAAATCTTGGTGTGGTACAAAAATATA
TTCAGTCATCAAAATTCAAAGAATTCTTTAGTGGATTAAATCCCGCTACGAAAGAGTTTAATGTTGTTTG
GCAGGATATAGCTTCAAGATATCCTCAGGAATTCAGAGAAGAACAACACCAATTTATTAAGAGAACTCAT
TATGATATACAAATAGGACATCTTAGAGGGAAAGGACTTTTGTTTGAACATAATCGAGCTGCTGTACATG
ATTTGATCTGGTCTACTTCAGTACAGTTTGGTGGGAGAACTAATTTGATTTTCAATGCATTGAATGGACA
AAATATGGAAAGTATGACTGATAAGGACATCATTATTCTGGTACAAGATTACAAGCTTGTTAATACAGAA
AGGCTTTTTAAGTCTTCGCCATCATGGTGGAGTGATTTAAAAAAACGTGCGGTATCAGAGAAAAAAGCTT
TACTTGAACTAGAAATTGACGGTTTGGAGGTTGATATAAAATGA