SecReT6
Protein ID: 446111937
SecReT6 ID790
T6SS typei1
Gene symbol-
Locus tagVCV52_A0127
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]32447..34216 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-209, Aligned region: 5..589
Protein Sequence: 589 a.a.     [Download]
>gi|446111937|ref|WP_000189792.1| type VI secretion protein [Vibrio cholerae V52]
MTQDKYFREELAFLKEQGKEFTEIHPQLSRFLHGRTTDPDVERLLEGFAFLTARLREKVEDEFPELTHSI
INMLWPNYLRPIPSMSVVAFEPDKSVSEKQVIPRNTQLDSKPVFGTACHFNTCRDVALYPMQCQGVHAEH
TREATTIQISLRMLGDMTVGDAKLDTVRFYLGGDKYSSQTLYLWLHHYLQKMTIEVQGVEFALPADAFST
VGFSSDQALLPYPKNVYDGYRILQEYLSFPEAFHFFDVKGFAKALPKAVSGDFTLRIHFSKTLPADTRVR
QDNFQLYCTPVINLFEHDADPIDLTGRRSEYRIVPSSRYPAHYEIFSVDQVVGWQDTQSEGKRIRGEKRI
YSSFESFQHEVERVRHRQALYYRTRVKESIRGDGFDSFISFVRGDETLSMGVDEAVSIKLTCTNRLLPLE
LGVGDICVATDSSPPFATFKNITVPSQSLRPVLDGSLLWTLISNLSLNYLSLLSKDALSCVLRAYDFRAL
VDRQAERVARMRLDGIVKIESKPVDKILRGLPVRGLQSTLYVDQAGFGSEGDLFLFGTVLSHFFALYASI
NSFHELVVVNISNQEKYSWGTQSGMQPLI
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0127|:32447-34216
ATGACGCAAGACAAGTATTTCAGGGAAGAGCTCGCTTTTTTAAAAGAGCAGGGGAAAGAATTTACCGAAA
TTCACCCTCAGCTTTCGCGTTTTCTTCATGGCCGTACGACCGATCCTGACGTTGAGCGTCTTTTGGAAGG
TTTTGCATTTCTTACCGCGCGTTTGCGCGAAAAGGTGGAGGATGAGTTCCCTGAACTTACTCACTCCATC
ATTAACATGCTGTGGCCAAATTATCTGCGCCCTATCCCGAGCATGAGTGTGGTGGCGTTTGAACCTGACA
AAAGTGTCAGCGAGAAGCAAGTCATCCCACGTAATACCCAATTGGATAGCAAGCCAGTCTTTGGCACGGC
GTGTCATTTCAACACTTGCCGTGATGTCGCGCTATATCCGATGCAGTGTCAAGGTGTTCATGCCGAGCAC
ACACGTGAAGCCACGACCATTCAGATCTCGTTGCGCATGTTGGGCGATATGACAGTAGGCGACGCTAAGC
TCGATACCGTACGTTTTTACTTAGGTGGTGATAAATACAGCTCGCAAACTCTCTATCTTTGGTTACACCA
TTATCTACAAAAAATGACGATTGAAGTGCAGGGTGTCGAGTTCGCACTGCCTGCTGATGCGTTTTCAACC
GTCGGTTTCTCAAGTGACCAAGCTTTGCTGCCTTATCCAAAGAATGTCTATGACGGTTATCGTATTTTGC
AAGAGTACCTGTCGTTTCCTGAAGCCTTTCACTTCTTTGATGTAAAAGGTTTTGCCAAAGCTTTACCGAA
AGCGGTCAGCGGTGATTTCACCTTACGCATCCATTTTTCGAAAACATTGCCTGCTGATACGCGAGTGCGT
CAGGACAATTTTCAACTCTATTGCACACCGGTCATCAATCTGTTTGAGCATGATGCCGATCCGATCGATT
TGACTGGGCGTCGTTCAGAGTATCGAATCGTCCCGTCCAGTCGCTATCCTGCCCACTATGAAATTTTCAG
CGTGGATCAAGTGGTTGGTTGGCAAGATACCCAGTCAGAAGGCAAACGGATCCGCGGAGAAAAGCGTATC
TACTCTTCTTTTGAAAGCTTCCAACATGAAGTGGAACGGGTTCGTCATCGTCAAGCGCTTTACTATCGCA
CACGAGTCAAAGAGAGCATCCGGGGGGATGGTTTTGATTCATTTATCTCTTTTGTGCGCGGTGATGAAAC
CTTATCAATGGGCGTAGATGAAGCCGTCTCAATCAAACTCACCTGCACCAATCGCTTGCTGCCATTGGAA
CTTGGGGTGGGGGATATTTGTGTGGCGACCGACAGCTCACCCCCTTTTGCCACATTCAAAAATATTACGG
TGCCTTCGCAGTCACTGCGCCCGGTTCTCGATGGCAGCTTACTGTGGACGCTGATCTCGAATCTATCGCT
GAACTACCTATCACTGCTCTCAAAAGATGCACTGAGCTGTGTGCTACGCGCTTACGATTTTCGCGCCTTG
GTCGATAGGCAAGCTGAACGTGTCGCACGGATGCGCCTTGATGGCATAGTCAAAATAGAATCTAAACCGG
TTGATAAAATCCTACGTGGTTTGCCTGTGCGTGGTTTGCAATCGACTTTGTATGTCGATCAAGCGGGATT
TGGCTCGGAAGGTGATTTGTTCCTGTTTGGTACGGTACTCAGTCATTTCTTTGCACTTTACGCCAGCATC
AACTCATTTCACGAATTAGTCGTGGTTAACATCAGCAATCAAGAGAAGTACTCATGGGGCACACAGAGCG
GAATGCAGCCGTTGATCTGA