SecReT6
Protein ID: 446143146
SecReT6 ID790
T6SS typei1
Gene symbol-
Locus tagVCV52_A0126
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]34222..34659 [-]
Productlysozyme
NoteTssE
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.50E-20, Aligned region: 37..127
Protein Sequence: 145 a.a.     [Download]
>gi|446143146|ref|WP_000221001.1| lysozyme [Vibrio cholerae V52]
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAPHLGLVDFNDA
TLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNSLTLRFHITATINSEALHEKVQFSLLLDQSR
KYRVF
 
Nucleotide Sequence: 438 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0126|:34222-34659
ATGACGTACATCGCACCTGAAGAGAGTGCATTTGGTGTTGGCTTTTTCGAACGTTTGGAAGCCAACGCCA
AACCTATGTCGCTGACCCGTGGGCCAGACGCGTGGGATGTACTCGAATCGATCAAACGGAATGTCTCTAA
CATTCTGAACACTCGAATTGGTGGAGCGCAAAGTGCCCCTCATCTCGGGTTGGTGGATTTTAATGATGCA
ACGCTGGAAACCTTAGATCTCTCCGTGCGAATTAAATTGGCGATTCAACAGTGCCTTGAGCGCTATGAGC
CGCGTTTAACTCGCGTTCTGGTGAGAGCGGATCAAGATAGCTTTAACTCGCTGACTTTAAGGTTCCACAT
TACCGCGACCATCAATAGCGAAGCGTTACACGAAAAAGTCCAGTTCAGTCTGTTATTGGATCAAAGCAGA
AAATATCGAGTGTTTTAA