SecReT6
Protein ID: 446348238
SecReT6 ID790
T6SS typei1
Gene symbol-
Locus tagVCV52_A0136
StrainVibrio cholerae V52
Repliconchromosome [GenBank: NZ_AAKJ02000013] [Browse all T6SS(s) in this replicon]
Location [Strand]21077..22486 [-]
Producttype VI secretion protein
NoteTssA
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-16, Aligned region: 49..109
PPDK_N [PF01326], Evalue: 0.0077, Aligned region: 81..199
Protein Sequence: 469 a.a.     [Download]
>gi|446348238|ref|WP_000426093.1| type VI secretion protein [Vibrio cholerae V52]
MEMTEYRQCVAKPISSSNPVGERLVDHPLFDFIEDQMMKVGSLSHASVQWDEVEHSTLKLLGEQSKDIKL
LVYLLQCLHNQVTPTRLITSFAVMSEFLNQYWNDSYPAPGPRGNLPRRKFFSQMAQRFTTVIEKFDFHHL
DEADRQALQAAVEEWQQAVEKQGLSSELVESVVVRITAEIKRAEQRQQVTAQSSAERETPSAATPSPAAS
MVVDHSSDKAAKQTLLKVADFLAEQEFGIALSIRLRRFAVWGSITSLPDHKPDGETLLRGMQADRVKDYQ
DQLRHPDLALWRKVEQSLTMAPYWFEGQWMSYTIAQQLGKSDWCQAIAEETQQFLRRLPSLLELKFKGGE
PFVSDSVKEWLASVGQSQGAAGQSVGGDWQEKRKEAFQLAKEGGIAVALSMLNDGLVSAVEPRDKFYWRL
LSADLLRANHLDAMAGEQYQTLLNQVTTLSVPEWEPSLVEQIQRYTTSE
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|121726954|gb|NZ_AAKJ02000013|VCV52_A0136|:21077-22486
ATGGAAATGACTGAATACCGTCAGTGTGTGGCCAAACCGATCAGCAGTAGCAATCCTGTCGGAGAGCGGC
TAGTCGATCACCCACTGTTTGATTTTATTGAAGATCAGATGATGAAAGTGGGCTCTCTCTCTCACGCTTC
AGTGCAGTGGGATGAAGTGGAGCACAGCACTCTCAAACTGCTTGGTGAACAGAGTAAAGACATCAAGCTT
TTGGTTTACCTGCTGCAGTGTCTGCATAACCAAGTTACCCCGACGCGCCTTATTACCTCGTTTGCGGTGA
TGAGTGAGTTCCTCAATCAATATTGGAACGACAGTTATCCAGCGCCGGGCCCACGTGGCAATCTGCCGCG
ACGTAAATTTTTCAGCCAGATGGCGCAACGTTTTACCACGGTGATCGAAAAGTTCGATTTTCATCATCTG
GATGAAGCGGATCGCCAAGCGCTACAAGCGGCGGTTGAAGAGTGGCAACAAGCCGTTGAGAAACAAGGGC
TCTCTTCTGAGTTGGTGGAGTCTGTGGTGGTGCGAATTACCGCGGAGATCAAACGCGCAGAGCAGCGCCA
GCAAGTGACGGCGCAAAGCAGCGCGGAGCGTGAAACACCAAGTGCTGCAACGCCTTCTCCTGCGGCGAGC
ATGGTGGTGGATCATTCGAGTGACAAAGCAGCGAAACAAACCCTACTCAAAGTGGCAGATTTTCTTGCCG
AACAAGAGTTTGGTATCGCGCTGTCGATTCGTCTGCGCCGCTTTGCGGTGTGGGGCAGCATTACCTCATT
GCCCGATCATAAACCCGATGGTGAAACACTGCTGCGTGGAATGCAGGCGGATCGCGTCAAGGATTACCAA
GATCAACTCCGTCACCCCGATTTAGCCTTGTGGCGCAAAGTCGAACAGAGCTTAACCATGGCTCCTTATT
GGTTTGAAGGACAGTGGATGAGTTACACCATTGCCCAGCAACTCGGCAAAAGTGATTGGTGTCAGGCGAT
TGCCGAAGAAACACAACAGTTTTTACGTCGTTTGCCTTCGCTGCTTGAGCTCAAATTCAAAGGCGGAGAG
CCGTTTGTCAGTGATTCGGTCAAAGAGTGGCTGGCGAGCGTAGGCCAGAGCCAAGGTGCTGCGGGGCAAT
CGGTCGGCGGAGATTGGCAAGAGAAGCGTAAAGAGGCGTTTCAACTGGCCAAAGAAGGCGGAATCGCCGT
GGCACTTTCCATGCTCAATGATGGCTTGGTGAGTGCAGTGGAGCCGCGTGACAAATTTTACTGGCGATTG
CTATCGGCGGATCTGCTGCGGGCAAATCATCTCGATGCGATGGCTGGTGAACAGTATCAAACTCTACTCA
ATCAGGTGACGACGCTGTCTGTTCCTGAGTGGGAACCGAGTTTAGTGGAACAAATTCAAAGATATACAAC
GTCAGAGTAA