SecReT6
Protein ID: 447916355
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06775
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1470483..1471952 [+]
Producthypothetical protein
NoteTssA
UniProt IDM4K1G8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.80E-20, Aligned region: 27..86
Protein Sequence: 489 a.a.     [Download]
>gi|447916355|ref|YP_007396923.1| hypothetical protein H045_06775 [Pseudomonas poae RE*1-1-14]
MRFSSEYDALEAELAKMQSIHSESQPDWQKVIETSECVLGEHSKDLRVAVWLVWALYQRESFAGLLAGIG
LLLHLCEQHWAVVYPLKLRTRRAAFGWLVLRLDPVFAKSVSVAGQQAVFHLLHEHLARLDECWSQHLGHD
APLLLSIRRQLSERLEPTAHGNPSPAALPHIMPNVKQVAAQLLKPEPAIENERDANKWLRTLQDQARPLC
NWWLRQGAADLRALRLSRTLAWLSLTRYPDADNQRTTTLRGPAGDKLKRCQERLAQGHYADLILELDASL
SSAMFWFDGLRMQWECLDALQANLAKTELEVSFALLLQRLPDLPEYRFYDGMPFADASTRDWIALHVARH
LQTNQPLALGKNIGAELWETALQEGLPKLRKDGLKAVVGEFTQGLQAARSERDRFHWRLAQARLCVLAGK
HELAKILLEQLDDHLQHAGLERWEPDLALQVAQLLFRCCELLPQDQAARERKEQTHRRLCHFDLEAVLE
 
Nucleotide Sequence: 1470 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1470483-1471952 Pseudomonas poae RE*1-1-14, complete genome
GTGCGCTTTTCCAGTGAATACGATGCCCTGGAGGCCGAGCTGGCGAAAATGCAATCGATACACAGTGAAA
GCCAGCCGGATTGGCAAAAAGTCATTGAAACCAGCGAGTGTGTGTTGGGCGAGCATTCCAAGGATCTGCG
TGTCGCGGTATGGCTGGTCTGGGCGCTTTACCAGCGTGAGTCGTTTGCTGGTCTGTTGGCCGGAATAGGT
CTCCTGCTGCATCTCTGCGAGCAGCATTGGGCAGTTGTCTACCCGCTCAAGCTGCGCACCCGCCGTGCGG
CTTTTGGCTGGCTGGTATTGCGCCTTGACCCCGTATTCGCCAAGAGCGTGTCAGTTGCAGGCCAGCAGGC
GGTATTTCATCTGCTCCACGAACATCTTGCGCGCCTTGATGAATGCTGGAGCCAGCATCTGGGTCACGAT
GCTCCATTGTTGTTGTCGATTCGCAGACAACTGTCGGAGCGCCTTGAACCGACCGCACACGGCAATCCAT
CTCCAGCGGCGTTGCCGCACATCATGCCCAATGTCAAACAGGTGGCGGCTCAATTGCTCAAGCCCGAGCC
CGCAATCGAAAACGAAAGGGATGCGAACAAATGGCTGCGCACCCTGCAGGACCAGGCACGCCCCTTGTGC
AACTGGTGGTTGCGCCAGGGCGCTGCAGACCTGCGCGCCTTGCGCCTGAGTCGAACACTGGCCTGGCTCT
CACTGACCCGTTACCCGGACGCAGATAACCAGAGAACCACGACCTTGCGTGGCCCCGCAGGCGACAAGCT
CAAGCGGTGCCAGGAGCGTCTTGCCCAGGGTCATTACGCCGATCTGATACTTGAGCTCGACGCAAGCCTG
AGCAGCGCAATGTTCTGGTTTGACGGACTGCGCATGCAGTGGGAGTGCCTTGACGCACTGCAGGCCAACC
TGGCGAAGACCGAGCTGGAGGTGAGTTTTGCGCTGTTGCTGCAGCGCCTGCCGGACCTGCCTGAGTATCG
CTTTTACGACGGCATGCCGTTTGCCGATGCCAGCACCCGGGACTGGATTGCGCTTCACGTGGCGCGCCAT
CTGCAAACAAACCAACCCCTGGCGCTGGGCAAAAACATCGGTGCCGAACTGTGGGAGACGGCATTGCAGG
AAGGGCTGCCCAAGCTGCGCAAGGACGGGCTCAAGGCTGTTGTCGGCGAGTTTACGCAGGGCCTGCAAGC
CGCGCGAAGCGAGCGCGACCGTTTCCATTGGCGCCTGGCTCAGGCCCGCCTGTGTGTGCTGGCAGGCAAA
CACGAGTTGGCGAAGATCCTGCTCGAACAGCTGGATGACCACCTGCAGCACGCAGGGCTGGAGCGCTGGG
AACCAGACCTGGCGCTGCAAGTCGCGCAGCTCTTGTTTCGCTGCTGTGAACTGCTGCCGCAAGACCAGGC
AGCGCGTGAGCGCAAAGAGCAAACCCATCGCAGGTTGTGCCACTTCGATCTTGAAGCGGTACTTGAATAG