SecReT6
Protein ID: 447916356
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06780
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1471988..1472485 [+]
Producthypothetical protein
NoteTssB
UniProt IDM4JXL7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.20E-53, Aligned region: 5..159
Protein Sequence: 165 a.a.     [Download]
>gi|447916356|ref|YP_007396924.1| hypothetical protein H045_06780 [Pseudomonas poae RE*1-1-14]
MPKEGSVAPKERINITFKPAVGGAQEEVELPLKLLVLGDFIQREDLRKLEDRKPVAIDKNTLDEVLAKQA
LSLTLSVPNRLQDDAEPEELGIQVNINSMQDFNPASLVEQIPELKKLMTLRDALMALKGPLGNTPSFRKA
IEQALADDESRTRVLAELGLARPSL
 
Nucleotide Sequence: 498 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1471988-1472485 Pseudomonas poae RE*1-1-14, complete genome
ATGCCCAAAGAGGGGTCTGTAGCACCGAAGGAACGCATCAATATCACGTTCAAACCTGCAGTGGGTGGTG
CGCAGGAAGAAGTAGAACTGCCGTTGAAACTGCTGGTGCTGGGAGACTTCATCCAGCGCGAGGACCTGCG
CAAGCTCGAAGACCGCAAACCTGTGGCGATCGACAAGAACACCCTGGATGAGGTGCTGGCCAAGCAGGCA
CTGAGCTTGACGCTCAGCGTACCCAATCGTCTCCAGGACGACGCCGAGCCAGAGGAGCTGGGTATTCAGG
TGAACATCAATTCAATGCAGGACTTCAATCCCGCAAGCCTGGTCGAGCAGATTCCCGAACTGAAAAAGCT
GATGACCCTGCGTGACGCATTGATGGCATTGAAGGGCCCGCTGGGTAACACGCCGAGCTTTCGCAAGGCT
ATCGAGCAGGCCCTGGCCGACGACGAGTCGCGCACGCGTGTACTCGCCGAATTGGGGCTGGCCCGGCCCT
CCCTATGA