SecReT6
Protein ID: 447916357
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06785
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1472511..1473986 [+]
Producttype VI secretion protein TssC2
NoteTssC
UniProt IDM4JXY0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-188, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|447916357|ref|YP_007396925.1| type VI secretion protein TssC2 [Pseudomonas poae RE*1-1-14]
MNTQATSLAAPRADESSILDNIIAQTLLTADDEAYGIAKRGVSAFIEELVKPHNSAEPVKKRLVDRMIAE
IDSKLSRQMDEILHHPQFQALEAAWRGLQLLIERTNFRENIKIELLNVSRADLLDDFEDSPEVNQSGLYK
HIYSAEYGQFGGQPVGAIIANYFLSPSAPDVKLMQYVSTVACVAHAPFIAAAGPAFFGLESFTGLPDLKD
LKDHFEGPQFAKWQSFRQSEDARYIGLTVPRFLLRTPYDPLESPVKTFAYQENVVNSHEHYLWGNTAYAF
ATRLTDSFARFRWCPNIIGPQSGGAVEDLPLHHFHSMGEIETKIPTEVLVSDRREYELAQEGFIALTMRK
GSDNAAFFSASSVQKPKYFGTSVEGREAELNYRLGTQLPYMMVVNRLAHYLKVLQREQLGSWKERTDLEL
ELNKWIRQYVADQENPSAEVRGRRPLRAARIVVSDVDGEPGWYRVNLSVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1472511-1473986 Pseudomonas poae RE*1-1-14, complete genome
ATGAACACTCAAGCCACCTCACTGGCTGCTCCCAGGGCAGACGAGTCGAGCATCCTCGACAACATCATTG
CGCAGACCCTGCTGACGGCGGATGACGAGGCCTACGGTATCGCCAAGCGCGGTGTCTCGGCGTTTATCGA
AGAGTTGGTCAAGCCGCACAACAGCGCAGAACCGGTCAAAAAACGCCTGGTGGACCGGATGATCGCCGAG
ATCGACAGCAAGCTCAGCAGGCAGATGGACGAAATTCTCCATCACCCGCAGTTCCAGGCACTGGAAGCTG
CCTGGCGAGGTTTGCAGTTGCTGATCGAGCGAACCAATTTCCGTGAAAACATCAAGATCGAACTGCTGAA
TGTATCCCGAGCGGACTTGCTCGATGACTTCGAGGACTCGCCGGAAGTCAACCAGTCCGGGCTCTACAAG
CATATCTACAGTGCCGAGTACGGCCAGTTCGGTGGTCAGCCCGTGGGCGCCATCATCGCCAACTATTTCC
TTTCACCCAGTGCGCCCGACGTAAAGCTCATGCAGTACGTTTCGACTGTCGCTTGCGTGGCTCACGCGCC
TTTTATCGCAGCGGCCGGGCCAGCCTTTTTTGGCCTGGAAAGCTTTACCGGTCTGCCTGACCTGAAGGAC
CTCAAGGATCATTTCGAAGGCCCGCAATTTGCCAAATGGCAGAGCTTTCGTCAGAGCGAAGACGCGCGCT
ACATCGGCCTCACCGTACCGCGCTTTTTGCTGCGCACGCCTTACGATCCCCTTGAATCTCCGGTCAAGAC
CTTTGCCTATCAGGAAAACGTGGTCAACAGTCACGAGCACTATCTGTGGGGGAATACGGCTTATGCATTT
GCCACACGCTTGACCGACAGCTTCGCCAGGTTTCGTTGGTGTCCCAACATCATTGGTCCGCAAAGCGGCG
GGGCGGTGGAAGACCTGCCCTTGCACCACTTTCACAGCATGGGTGAAATCGAAACGAAGATCCCCACTGA
GGTGCTGGTCTCCGATCGACGCGAATATGAACTGGCCCAGGAGGGGTTCATCGCGTTGACCATGCGCAAA
GGCAGTGACAATGCGGCATTTTTCTCCGCAAGTTCGGTGCAGAAGCCCAAGTATTTCGGCACCAGTGTCG
AGGGGCGGGAAGCGGAGTTGAATTACCGGCTGGGCACTCAGTTGCCGTACATGATGGTGGTCAACCGACT
GGCTCATTACCTGAAAGTGTTGCAGCGCGAGCAGTTGGGGTCGTGGAAGGAACGCACCGACCTGGAACTT
GAACTCAATAAATGGATTCGTCAGTACGTCGCAGACCAGGAAAACCCCAGTGCCGAGGTGCGTGGTCGTC
GACCCCTGCGTGCGGCACGCATCGTTGTCAGCGATGTTGACGGTGAGCCCGGCTGGTATCGCGTCAATCT
GAGTGTGCGGCCTCACTTCAAATATATGGGGGCGGACTTCACGCTTTCCCTTGTCGGCAAGCTCGACAAA
GAATGA