SecReT6
Protein ID: 447916358
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06790
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1474001..1474402 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDM4K476
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.50E-17, Aligned region: 19..108
Protein Sequence: 133 a.a.     [Download]
>gi|447916358|ref|YP_007396926.1| GPW/gp25 family protein [Pseudomonas poae RE*1-1-14]
MTCHHSLFERLEGHTSARSGGMASVAAHLGKMLSTRAGSVQTAGDYGLPDLNDMRQSLHESLSQSRLSIE
RFIQAYEPRLTNVRVRALPRDRDPLVLAFSIAAMLVIDGEARAVAFSAHLGGGGQVEVAPDDL
 
Nucleotide Sequence: 402 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1474001-1474402 Pseudomonas poae RE*1-1-14, complete genome
ATGACCTGTCACCACAGCCTTTTCGAGCGCCTCGAAGGCCACACATCCGCTCGGTCGGGCGGCATGGCCT
CGGTGGCTGCCCACTTGGGGAAAATGCTCAGCACGCGCGCCGGCAGTGTCCAGACTGCAGGCGATTATGG
CCTGCCGGATCTCAATGACATGCGCCAGAGCCTGCATGAGTCCTTGAGCCAGTCGCGCCTCTCGATCGAG
CGCTTTATCCAGGCCTACGAACCACGCCTGACGAATGTTCGTGTCAGGGCGCTGCCGCGTGACCGCGATC
CCCTGGTCCTGGCATTTTCCATAGCAGCGATGCTTGTGATTGACGGTGAGGCCCGGGCCGTGGCTTTCAG
CGCGCACCTGGGCGGCGGCGGGCAGGTGGAGGTCGCGCCGGATGACCTTTAA