SecReT6
Protein ID: 447916360
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06800
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1476143..1477150 [+]
Producttype VI secretion protein TssG2
NoteTssG
UniProt IDM4K1H2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.40E-80, Aligned region: 20..320
Protein Sequence: 335 a.a.     [Download]
>gi|447916360|ref|YP_007396928.1| type VI secretion protein TssG2 [Pseudomonas poae RE*1-1-14]
MATPFGPAALALTELSRCVREYSLFQAVLLVIERLREAHPLLDEDALYDQLEFQANPSLGFPGHDIDQVE
FFVEQGQLRARLRLNVLGLFGAGSPLPAFYGEQACAEPMGVNVTRDFLNVFHHRLQRLMLPIWRKYRYRA
RFRNGASDGFSAQMFALIGLGSREVRSAARLDCRRLLPYLGLLGLRAHSASMIETVLRHYFKHSRVFIEQ
WVERRVCIDRQQRNRLGVIHHALGHDLVLGQQVADRCGKFKVHLMELSWQRFHAFLPTGKAFLPLCSLVQ
LTARAPLAFDLRLVLAEGEIRALHIGERNVCRLGWTSWLAHERADGALTLAGHSD
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1476143-1477150 Pseudomonas poae RE*1-1-14, complete genome
ATGGCCACCCCGTTTGGGCCTGCAGCCCTTGCTTTAACTGAACTGTCGCGGTGCGTTCGCGAATATTCGC
TGTTCCAGGCGGTGCTTCTGGTGATCGAACGCCTGCGTGAGGCTCATCCGTTGCTGGACGAGGATGCGTT
GTATGACCAACTGGAATTCCAGGCCAATCCCAGTCTTGGCTTTCCGGGGCATGACATAGACCAAGTGGAG
TTTTTTGTGGAACAGGGTCAATTACGCGCGCGGTTGCGCCTCAATGTCCTGGGGCTGTTTGGCGCGGGTT
CGCCGCTGCCGGCGTTCTATGGCGAGCAGGCGTGTGCAGAACCCATGGGGGTCAACGTCACACGAGACTT
CCTGAACGTCTTTCACCATCGCCTGCAACGGCTGATGTTGCCGATCTGGCGCAAGTACCGCTATCGAGCG
CGCTTTCGAAACGGGGCCAGCGATGGTTTTTCGGCACAGATGTTCGCCCTGATCGGCCTGGGAAGCCGGG
AAGTTCGCTCAGCGGCACGTCTGGATTGCCGACGCCTGCTGCCTTACCTGGGCTTGTTGGGTCTGCGGGC
ACATTCGGCGTCGATGATCGAGACAGTGTTGCGCCACTACTTCAAGCACAGCCGGGTGTTCATCGAGCAG
TGGGTGGAGCGCCGTGTCTGCATCGACCGGCAGCAGCGCAACCGGCTGGGCGTTATCCACCATGCGCTCG
GCCACGACCTGGTGCTGGGGCAGCAAGTAGCGGATCGCTGCGGCAAGTTCAAGGTGCACCTGATGGAGCT
CAGCTGGCAGCGCTTTCACGCGTTTCTGCCCACCGGAAAGGCGTTCCTGCCCTTGTGTTCCCTGGTGCAG
CTAACGGCACGCGCGCCGCTTGCGTTCGACCTGCGCCTGGTACTGGCAGAGGGCGAAATACGCGCGCTGC
ACATCGGCGAGCGCAATGTCTGTCGCCTTGGCTGGACCAGCTGGCTGGCCCATGAACGTGCTGATGGAGC
GCTCACGCTCGCCGGCCACTCTGATTAG