SecReT6
Protein ID: 447916361
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06805
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1477163..1479601 [+]
ProductClpA/B-type protease
NoteTssH
UniProt IDM4JXL9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.60E-39, Aligned region: 203..221
AAA_2 [PF07724], Evalue: 2.60E-39, Aligned region: 545..710
AAA [PF00004], Evalue: 3.10E-17, Aligned region: 204..315
AAA [PF00004], Evalue: 3.10E-17, Aligned region: 550..674
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 204..221
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 264..334
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 549..665
ClpB_D2-small [PF10431], Evalue: 1.90E-12, Aligned region: 717..789
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 7..55
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 181..221
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 248..282
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 423..499
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 518..590
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 614..643
AAA_16 [PF13191], Evalue: 2.50E-12, Aligned region: 708..736
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 130..174
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 203..285
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 548..643
IstB_IS21 [PF01695], Evalue: 2.20E-06, Aligned region: 187..239
IstB_IS21 [PF01695], Evalue: 2.20E-06, Aligned region: 549..567
IstB_IS21 [PF01695], Evalue: 2.20E-06, Aligned region: 738..781
NACHT [PF05729], Evalue: 3.10E-05, Aligned region: 204..232
NACHT [PF05729], Evalue: 3.10E-05, Aligned region: 549..596
AAA_29 [PF13555], Evalue: 9.00E-05, Aligned region: 198..221
AAA_29 [PF13555], Evalue: 9.00E-05, Aligned region: 547..574
AAA_19 [PF13245], Evalue: 0.00011, Aligned region: 44..71
AAA_19 [PF13245], Evalue: 0.00011, Aligned region: 201..222
AAA_19 [PF13245], Evalue: 0.00011, Aligned region: 547..571
Clp_N [PF02861], Evalue: 0.00028, Aligned region: 34..69
Clp_N [PF02861], Evalue: 0.00028, Aligned region: 103..122
Arch_ATPase [PF01637], Evalue: 0.00049, Aligned region: 184..220
Arch_ATPase [PF01637], Evalue: 0.00049, Aligned region: 257..288
Arch_ATPase [PF01637], Evalue: 0.00049, Aligned region: 548..561
Sigma54_activat [PF00158], Evalue: 0.00058, Aligned region: 200..218
Sigma54_activat [PF00158], Evalue: 0.00058, Aligned region: 549..665
AAA_25 [PF13481], Evalue: 0.00076, Aligned region: 203..243
AAA_25 [PF13481], Evalue: 0.00076, Aligned region: 546..578
AAA_25 [PF13481], Evalue: 0.00076, Aligned region: 717..748
AAA_17 [PF13207], Evalue: 0.0044, Aligned region: 204..218
AAA_17 [PF13207], Evalue: 0.0044, Aligned region: 548..572
IL11 [PF07400], Evalue: 0.0047, Aligned region: 389..504
DUF258 [PF03193], Evalue: 0.0081, Aligned region: 184..219
DUF258 [PF03193], Evalue: 0.0081, Aligned region: 549..560
Hpr_kinase_C [PF07475], Evalue: 0.0088, Aligned region: 205..215
Hpr_kinase_C [PF07475], Evalue: 0.0088, Aligned region: 546..578
Protein Sequence: 812 a.a.     [Download]
>gi|447916361|ref|YP_007396929.1| ClpA/B-type protease [Pseudomonas poae RE*1-1-14]
MINVDLQQLIRTLAAQTRYDLERSAERCVARGGREVLVEDLLLALLEHADGLLVQALADAGVQLSELEST
LYPKSEHSATRNPVFATTLVHWLQQGLMVAHVELGQPEVDQGALLLALLRHPLEHAGSAYQKVLSRLDIE
RVRSFLQSNPPQAHTPAADSLLQRFTHDLTHQAREGLIDPVLCRDAEIRQLVDILTRRRKNNPILIGEAG
VGKTAIVEGFALQVVASRVPPSLQQVRVLTLDLGLLQAGAGIKGEFERRLKGVIDEVNASPQRVILFIDE
AHTLVGTGGQGGASDSANLLKPALARGELRTIAATTWSEYKKYIEKDPALARRFQPIRVGEPGVEQAVSI
LRGLVPVYEASHGVYVRDDAVVAAAHMSARYLAGRQLPDKAVDVLDTACARARTHLAVPPETLQRASAEL
AEGRQHQHALRRDADAGLPVDGSVLQALQSRLKAVECEHQALEQTWLAQREQSPEQPEVCPRLVAQVISA
WTGIPAEQLVLEHSDKVLGFADALRARILGQDHAVQALDRCLRAMAAGLNEPDAPVGVFLLVGPSGVGKT
ETALALADLLYGGRRFVTTLNMSEYQEQHSLSRLIGAPPGYVGYGEGGVLTEAVRQRPYSVVLLDEVEKA
DPQVLNLFYQVFDKGLANDGEGREIDFRNTLILMTSNLGSDSISALCADGQRPKLEVLHEAILPSLRAWF
KPALLARMRVVPYYPISAEVLGEVVRLKLDRLGQRLARRKLAFTYTPQLLAHMAQRCAHGDSGARYIDQW
IETDLLPQIVDRLLAATAAGESLSLAHASLDSTGRPACEFSQ
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1477163-1479601 Pseudomonas poae RE*1-1-14, complete genome
ATGATCAATGTAGATCTGCAACAACTTATCCGCACCCTGGCCGCGCAGACCCGATACGACCTCGAGCGAT
CAGCCGAGCGCTGTGTTGCACGCGGTGGTCGCGAGGTGCTGGTGGAGGACCTGCTGCTGGCGTTGCTGGA
ACACGCCGACGGCTTACTGGTGCAGGCTCTGGCGGATGCGGGCGTGCAATTGTCGGAACTCGAGTCGACG
CTTTATCCAAAGAGCGAACACAGTGCAACCCGCAACCCGGTTTTCGCGACGACGCTGGTCCACTGGTTGC
AACAGGGACTGATGGTTGCGCACGTCGAATTGGGGCAGCCGGAGGTCGATCAGGGCGCCTTGTTGCTGGC
GCTGCTGCGTCATCCTCTGGAACATGCGGGCAGCGCGTACCAGAAGGTGCTGAGTCGTCTGGATATCGAG
CGCGTGCGCAGCTTTCTGCAAAGCAATCCGCCGCAGGCGCATACCCCGGCAGCGGACTCGTTGTTGCAGC
GCTTCACCCATGACCTCACACACCAGGCACGTGAAGGTCTGATTGACCCGGTGCTGTGTCGTGATGCCGA
AATTCGACAGTTGGTCGACATCCTTACCCGCCGGCGCAAGAACAACCCGATTCTGATCGGAGAGGCCGGT
GTTGGGAAAACCGCAATTGTCGAAGGCTTTGCCCTGCAAGTCGTCGCATCTCGGGTGCCGCCGTCGCTTC
AGCAGGTGCGCGTACTCACTCTGGATCTGGGCCTGTTGCAAGCAGGGGCGGGGATCAAGGGTGAGTTCGA
GCGCCGCCTCAAGGGGGTGATCGACGAGGTCAACGCGTCGCCCCAGCGAGTGATCCTGTTTATCGATGAG
GCCCATACTCTGGTGGGCACGGGCGGGCAGGGCGGTGCGTCCGACTCGGCGAACCTGCTCAAGCCAGCTC
TGGCCCGTGGCGAGCTGCGTACCATCGCCGCCACCACGTGGTCGGAATACAAAAAATATATCGAGAAAGA
CCCGGCGCTGGCGCGACGCTTTCAACCGATACGGGTGGGCGAGCCCGGTGTCGAGCAAGCCGTCTCTATC
CTGCGCGGGCTGGTCCCAGTCTACGAGGCCAGCCACGGTGTATACGTACGCGACGATGCCGTCGTCGCGG
CGGCACACATGAGCGCGCGTTACCTGGCGGGGCGGCAGCTACCGGACAAAGCGGTGGATGTATTGGACAC
CGCCTGTGCACGGGCGCGTACACATCTGGCCGTGCCCCCTGAAACGTTGCAGCGTGCAAGCGCCGAACTG
GCCGAAGGCCGTCAGCACCAGCATGCGTTGCGCCGCGACGCTGATGCCGGTTTGCCCGTCGACGGATCCG
TGCTGCAAGCACTGCAATCGCGGCTCAAGGCTGTTGAGTGCGAGCACCAGGCGCTGGAACAGACCTGGCT
TGCACAACGTGAGCAATCACCCGAACAGCCCGAGGTTTGCCCACGCCTGGTGGCTCAGGTCATCAGCGCA
TGGACCGGCATTCCCGCCGAGCAACTGGTGCTTGAACACAGCGACAAGGTCCTGGGTTTTGCCGATGCGC
TGCGCGCACGCATTCTTGGCCAGGATCACGCGGTGCAGGCGCTCGACCGTTGCCTGCGCGCCATGGCGGC
AGGGCTGAACGAGCCTGATGCGCCGGTGGGTGTGTTTCTGCTGGTCGGACCGAGCGGCGTGGGCAAGACC
GAAACGGCACTGGCGCTGGCGGACCTGCTGTACGGCGGCCGACGGTTTGTCACCACTCTCAATATGTCGG
AATACCAGGAGCAACATTCACTGTCCCGATTGATCGGTGCACCGCCCGGTTATGTCGGCTATGGCGAAGG
CGGCGTCCTCACCGAAGCGGTACGTCAGCGCCCGTATTCGGTGGTATTGCTCGACGAGGTGGAGAAGGCT
GACCCCCAGGTGCTGAACCTGTTCTACCAGGTGTTCGACAAGGGCCTGGCCAATGATGGTGAAGGTCGTG
AGATCGACTTTCGCAACACCCTGATCCTGATGACCTCCAACCTCGGCAGCGACAGCATCAGCGCCTTGTG
TGCCGATGGCCAGCGCCCCAAGCTCGAGGTTTTGCACGAGGCGATTCTTCCGTCGTTGCGCGCCTGGTTC
AAGCCCGCATTGCTGGCGCGGATGCGCGTGGTGCCCTATTACCCGATTTCCGCTGAGGTGCTGGGTGAGG
TGGTCAGGCTCAAGCTCGACCGTCTCGGGCAGCGGCTGGCCCGGCGCAAGCTGGCGTTCACCTATACGCC
GCAATTGCTTGCGCACATGGCCCAACGCTGTGCCCATGGTGACAGCGGCGCACGCTACATCGATCAATGG
ATCGAGACCGACCTGCTGCCACAGATCGTGGACCGCCTGCTCGCGGCAACGGCCGCGGGCGAGTCTCTCT
CGTTGGCCCATGCGTCGCTGGACAGTACCGGCCGGCCGGCGTGTGAGTTCAGCCAATGA