SecReT6
Protein ID: 447916364
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06820
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1481333..1482505 [+]
Producttype VI secretion protein Fha2
NoteFha
UniProt IDM4JZ12
KEGG IDppz:H045_06820
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.80E-11, Aligned region: 29..97
Protein Sequence: 390 a.a.     [Download]
>gi|447916364|ref|YP_007396932.1| type VI secretion protein Fha2 [Pseudomonas poae RE*1-1-14]
MQLMFEVYESAGADPASMAPKLFTEAGGVIGRGAGCDWVIADSSRLLSSHHGLVSFREGQYFLTDISSNG
ICVAGSGERLCKGQARLVEDGDVFQLGALFIRARLVASPAPQGELQRAAGGQIPDDAFLGLDPSRAMDQA
SLPPDDILATSDEPAQRVYQQAPDRDYMSLPRRVEPVPDGPPLEDLERTPALHASFWAQFSAALGLDLNG
VDTPRREALAIKVASLLKQGIEGLQQSLRTCDELKNESNLAPSEARLRSANPLRHCSDGKAALAALLGMN
EWGQLPAEAALVQAHRDLQSHQVALLTACRTALRNGYRVFAPSHLMLCFERQEKAPWFNADGAHWRAYQR
HYQRLIEEEPLSERLLGNDFANAYEEQVRLISTLHAACPG
 
Nucleotide Sequence: 1173 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1481333-1482505 Pseudomonas poae RE*1-1-14, complete genome
ATGCAACTGATGTTTGAAGTGTATGAAAGCGCAGGCGCAGATCCCGCGTCTATGGCCCCTAAACTGTTCA
CCGAGGCCGGTGGCGTGATTGGGCGTGGCGCCGGTTGCGATTGGGTCATTGCCGACTCCAGTCGGCTGCT
GTCCAGTCACCATGGGTTGGTGAGTTTTCGCGAAGGTCAGTATTTTCTGACCGACATCAGCAGCAATGGA
ATCTGTGTGGCGGGCAGCGGTGAGCGGCTGTGCAAAGGGCAGGCACGCCTGGTCGAAGATGGCGATGTAT
TCCAGCTGGGCGCACTGTTCATTCGGGCGCGGCTGGTCGCATCACCGGCCCCGCAGGGCGAACTGCAGCG
CGCGGCGGGTGGGCAGATTCCCGACGATGCTTTCCTGGGGCTGGATCCGAGCCGGGCAATGGATCAGGCC
TCGCTGCCACCGGACGACATCCTCGCTACCAGCGACGAACCCGCGCAACGGGTTTATCAGCAAGCGCCAG
ACAGGGACTATATGAGCCTGCCACGCCGGGTCGAGCCTGTTCCTGATGGACCACCGCTTGAAGATCTCGA
AAGGACACCGGCTTTGCACGCGTCGTTCTGGGCGCAGTTTTCGGCGGCACTCGGACTTGACCTCAACGGT
GTCGACACCCCACGGCGCGAGGCGTTGGCAATCAAAGTCGCCAGTTTGCTCAAGCAGGGTATCGAGGGCT
TGCAGCAAAGCCTGCGCACCTGCGACGAGCTGAAAAACGAATCGAACCTTGCGCCTTCCGAAGCCCGCCT
GCGCAGTGCCAACCCCCTGCGCCATTGCTCCGACGGTAAAGCGGCATTGGCGGCGTTGCTGGGTATGAAC
GAGTGGGGGCAATTGCCGGCCGAGGCCGCCCTGGTCCAGGCCCACCGGGATCTGCAATCCCATCAGGTAG
CCCTGCTGACAGCGTGTCGCACCGCACTGCGCAATGGGTACCGGGTATTCGCGCCCAGCCACTTGATGTT
GTGCTTCGAGCGCCAGGAAAAAGCTCCCTGGTTCAATGCCGACGGGGCGCACTGGCGCGCCTACCAACGC
CATTATCAACGCCTGATCGAGGAAGAACCGTTGAGCGAGCGCCTGTTGGGCAATGACTTTGCCAATGCCT
ACGAAGAGCAGGTTCGCCTGATTTCCACCCTTCATGCGGCTTGCCCGGGATGA