SecReT6
Protein ID: 447916365
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06825
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1482535..1482996 [+]
Producttype VI secretion lipoprotein TssJ2
NoteTssJ
UniProt IDM4K1H5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-35, Aligned region: 7..140
Protein Sequence: 153 a.a.     [Download]
>gi|447916365|ref|YP_007396933.1| type VI secretion lipoprotein TssJ2 [Pseudomonas poae RE*1-1-14]
MLVLLGVLAGCSALSPFSTLTKVDLTVTANERVNPDLHGRPSPVVMQLIELRHPAAFENADFFSLYGRAE
QTLPKDWVSGEELEMRPGERLALKLSVGPHSRYVGVLAAYRDLPHVQWRLLVPVTPGRLTRADLMLDEDG
IRLANLSADALEN
 
Nucleotide Sequence: 462 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1482535-1482996 Pseudomonas poae RE*1-1-14, complete genome
ATGCTGGTGTTACTCGGCGTGTTGGCCGGGTGCAGCGCACTGTCGCCTTTTTCGACCCTGACCAAAGTTG
ACCTGACAGTGACGGCCAATGAGCGGGTCAATCCCGATCTGCACGGTCGTCCCTCTCCGGTGGTCATGCA
ACTGATCGAGCTGCGCCACCCCGCAGCGTTCGAAAACGCGGACTTCTTCAGCCTGTATGGGCGTGCCGAG
CAGACGCTGCCCAAGGACTGGGTAAGCGGCGAGGAACTGGAAATGCGCCCCGGCGAACGCCTGGCGCTCA
AGCTCAGCGTCGGGCCGCACAGTCGCTATGTGGGAGTGCTCGCAGCCTATCGCGACTTGCCTCACGTGCA
GTGGCGGTTGTTAGTGCCCGTGACGCCTGGCCGACTGACCCGCGCCGACCTGATGCTGGACGAGGACGGC
ATACGTCTGGCCAACCTGTCCGCCGATGCGCTGGAGAATTGA