SecReT6
Protein ID: 447916366
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06830
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1482998..1484326 [+]
Producttype VI secretion protein TssK2
NoteTssK
UniProt IDM4JXM3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-127, Aligned region: 18..441
Protein Sequence: 442 a.a.     [Download]
>gi|447916366|ref|YP_007396934.1| type VI secretion protein TssK2 [Pseudomonas poae RE*1-1-14]
MQAHNVIWQEGMLLRPQHLQHQDRYYNQQLNRTRLLGSDAWGFLSLEVDVQYLKLGKFVVTQASGVLPDG
SLFELSSAMEPLVLQVPANAGRQGIYLALPLAIGNQIEARKPEQVDVVARYVSSTTEVGDSNAGSDSRCQ
ISCGRPDLRLLLGEQHSDQTFVTLQVAQVLDATKDDGVSLDADFVPTFIYLQGSGYVGACLKEVISLLAC
RGDAIAERVQGNGAASGTHIADFLMLQLINRGELVLRHYLSQAQVRPQALYRELLGILGELSTFAHDTRR
AQWDVLYRHHDQGASFRGLMDGLRTALSMVLEQHAMELVLHPRQYGVLVCPVRDLKLLGSATFVLAASAH
CDSEQLRQRLPAHLKVGPVERIRELVNLHLAGIKVKPLPVAPRQLPFHAGKTYFMLELTARDITQLEQSG
GFAFHVGGEFTALELNFWAIRN
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1482998-1484326 Pseudomonas poae RE*1-1-14, complete genome
ATGCAGGCTCATAATGTCATCTGGCAGGAAGGCATGCTGTTGCGGCCCCAGCACCTGCAGCATCAGGACC
GCTATTACAACCAGCAACTCAATCGCACCCGTTTGTTGGGCAGTGATGCCTGGGGGTTTCTCAGCCTTGA
AGTGGATGTGCAGTACCTCAAGCTGGGCAAGTTTGTCGTGACCCAGGCCAGTGGCGTGCTGCCCGACGGC
AGCCTGTTCGAGCTGAGCAGCGCCATGGAACCGCTGGTGCTGCAGGTGCCGGCCAACGCCGGCAGACAGG
GTATCTACCTGGCATTACCGTTGGCGATCGGCAATCAGATCGAAGCCCGTAAACCCGAGCAGGTCGATGT
GGTGGCTCGCTATGTCAGCTCCACCACGGAGGTCGGCGATTCGAATGCGGGGAGCGACTCGCGCTGCCAG
ATCAGCTGTGGACGCCCGGATCTGCGTCTGTTGCTGGGCGAGCAGCACAGCGACCAGACCTTCGTGACGC
TTCAGGTCGCTCAGGTACTGGACGCCACGAAGGACGACGGCGTGAGCCTGGATGCGGATTTCGTACCCAC
CTTCATCTACCTCCAGGGCTCGGGTTATGTGGGCGCGTGTCTCAAGGAAGTGATCAGTCTGCTGGCTTGT
CGCGGGGACGCCATTGCCGAGCGCGTTCAGGGCAATGGTGCGGCTTCGGGGACGCACATTGCGGACTTTC
TGATGCTGCAGTTGATCAATCGGGGCGAACTGGTACTGCGTCATTACCTGAGTCAGGCCCAGGTTCGTCC
GCAAGCGCTGTACCGAGAGTTGCTGGGCATCCTCGGTGAATTGTCGACCTTTGCCCATGACACCCGACGG
GCGCAGTGGGACGTGCTTTATCGACACCACGACCAGGGCGCCAGTTTTCGTGGCTTGATGGACGGGCTGC
GAACCGCGCTATCCATGGTGCTGGAGCAGCATGCCATGGAACTGGTGTTGCATCCGCGCCAGTACGGCGT
GCTGGTCTGCCCGGTGCGCGACCTCAAGTTGCTGGGCAGCGCGACCTTCGTGCTAGCGGCCAGCGCGCAC
TGTGACTCGGAGCAACTGCGCCAGCGATTGCCGGCCCACCTCAAGGTTGGACCAGTGGAGCGTATACGCG
AGCTGGTCAACCTGCACCTGGCTGGCATCAAGGTCAAGCCGTTGCCGGTGGCGCCGCGCCAACTGCCGTT
TCATGCCGGAAAAACCTATTTCATGCTCGAGCTCACTGCTCGGGATATCACGCAACTGGAGCAGTCAGGT
GGGTTTGCCTTCCATGTCGGCGGCGAGTTTACCGCGCTCGAACTCAACTTCTGGGCTATCAGGAACTGA