SecReT6
Protein ID: 447916367
SecReT6 ID728
T6SS typei1
Gene symbol-
Locus tagH045_06835
StrainPseudomonas poae RE*1-1-14
Repliconchromosome [GenBank: NC_020209] [Browse all T6SS(s) in this replicon]
Location [Strand]1484332..1485198 [+]
Productputative outer membrane protein
NoteTssL
UniProt IDM4JXY5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-59, Aligned region: 61..265
LEH [PF07858], Evalue: 0.0085, Aligned region: 73..124
LEH [PF07858], Evalue: 0.0085, Aligned region: 153..169
Protein Sequence: 288 a.a.     [Download]
>gi|447916367|ref|YP_007396935.1| putative outer membrane protein [Pseudomonas poae RE*1-1-14]
MNRDSDYPQDEKTVLLDRDGLGPVQGPMTDFPTPPRFEQLEDRMIYAAQAQGLQMFNAGLNPLLSAAWEL
LSQPHRLSASVGRESLHTLNERLSAGITQFETRALHEGVDHAAVMSARYVICSVLDEAVVTTSWGTAGDW
SKMSLLSRFHNETFGGEKVFQLLERLSRDPLKHLALLELLYLCLSLGFEGKYRVMERGVVQLEAVRDGVY
RQIRQVRGDPPPVLVLPSTTEPVRRKRRVLISAPWAGAVCLLSLLAMYSGFAWMLATERTKVLQPFQYSA
PDLTRTPL
 
Nucleotide Sequence: 867 bp     [Download]
>gi|447915004|ref|NC_020209.1|:1484332-1485198 Pseudomonas poae RE*1-1-14, complete genome
ATGAACAGGGACAGTGATTATCCTCAGGACGAGAAAACCGTCCTGCTCGACCGCGACGGTCTGGGACCAG
TCCAGGGGCCGATGACGGATTTCCCCACGCCGCCGCGTTTCGAACAACTGGAAGACCGGATGATCTACGC
CGCTCAGGCGCAGGGTCTGCAGATGTTCAATGCAGGGCTCAATCCCTTGTTGTCCGCAGCGTGGGAACTG
CTGTCGCAGCCGCATCGGCTCAGTGCCAGCGTCGGCCGCGAGAGTTTGCATACCCTCAATGAACGGCTGT
CGGCTGGGATTACGCAGTTCGAGACACGCGCCCTGCATGAAGGCGTGGATCACGCCGCGGTCATGTCGGC
GCGCTATGTGATCTGCAGTGTGCTGGACGAAGCCGTGGTCACCACCTCATGGGGCACCGCCGGAGACTGG
TCAAAGATGAGCCTGCTCAGTCGCTTTCATAACGAAACCTTCGGGGGCGAAAAGGTCTTCCAGTTGCTGG
AGCGACTGTCCCGCGATCCGCTCAAGCACCTCGCATTGCTTGAACTGCTGTACCTGTGCCTGTCGTTGGG
CTTCGAGGGCAAATACCGGGTGATGGAGCGCGGCGTGGTGCAGCTTGAAGCGGTACGCGACGGTGTGTAT
CGACAGATCCGACAGGTCAGGGGAGACCCGCCTCCGGTGCTGGTTTTGCCGTCGACAACGGAGCCGGTAC
GCCGCAAAAGGCGGGTGCTGATCTCCGCACCCTGGGCGGGGGCAGTGTGCCTGCTCAGCCTGCTGGCAAT
GTACTCGGGTTTTGCCTGGATGTTGGCCACCGAGCGCACGAAGGTGCTGCAACCCTTTCAATATTCGGCG
CCGGACCTGACTCGGACGCCCCTGTAA