SecReT6
Protein ID: 448242760
SecReT6 ID730
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c30000
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3235473..3237812 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDL7ZNK9, L7ZNK9
KEGG IDsmw:SMWW4_v1c30000
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.40E-82, Aligned region: 25..328
Phage_GPD [PF05954], Evalue: 7.40E-82, Aligned region: 640..681
Phage_base_V [PF04717], Evalue: 9.00E-25, Aligned region: 366..459
Protein Sequence: 779 a.a.     [Download]
>gi|448242760|ref|YP_007406813.1| Rhs element Vgr protein [Serratia marcescens WW4]
MDRLIIAHTPLPANQLLFRSLSGEEKLAGLFEFDVELLSPDNRLDLKALLGQKITLELRGNPLAPRYLNG
NITRMTLSGREAGGNRYYIYRAVLRPTLWYLTQNRDFRIYQEQTVPDILTQVLGQYQVKIDNRLSYDYRI
WGYCVQYQESDFDFISRLMEHEGIYYYFTHQQDGHTLVLADAPAAHQELAGYASIPYQLAEGGLVENKDS
INSWSVSDAITPSLYSLDDYDFRKPRARLLEARQNPASFAQDKAEVFDWPGRYTDHAHGQFYVKVRQQEF
EAQHEQMSGEGNSQGIAPGYRFQLTQAPRMEDNRTYLVVSAHYFMQENSYTSNDNDVGEQRTEFQVVPAD
INWRPARTTPWPKTHGPQTAEVVGPEGESIWTDKYGRVKLKFRWDRHGSGNETSSCWVRVSSAWAGWKYG
GIQIPRVGEEVVVDFINGDPDRPIITGRVYNEDSMPPWDLPGDATKMGFMSRSKGGGVDNASFLFLEDSP
GNESFDMHAERNMNMTVENDKNVNIDGSRTTTIGRQQDDTVTGDATFLYKAKRTTTVNGLETANLNAHQT
VNIKGGRDLTIIDGGDKIDITGNQSFKLDGAQTQNITQTQHVTVKGNQTLDITEGQQTSTIKQGQTVNIT
SGGQHTTITAGGQELTIKGGGQTATVTGDVTETYKNDQSTTITGTLTIKAKTINITSADGVSVQTPSWKD
NCHGLKWVATGANFAFYGSNLALTGASLKHTMLDISHNPLSISKTNFKLSNDPMTFTQLGALVTNGALRL
STKALAIFL
 
Nucleotide Sequence: 2340 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3235473-3237812 Serratia marcescens WW4, complete genome
ATGGATCGCCTTATCATTGCGCACACGCCTTTGCCCGCCAATCAGCTGTTGTTCAGAAGCCTTTCCGGTG
AGGAAAAACTGGCCGGCCTGTTCGAATTCGACGTCGAGCTGCTCAGCCCCGACAATCGGCTCGATCTGAA
AGCGCTGCTGGGACAAAAAATCACGCTGGAACTGCGGGGCAATCCGTTGGCGCCGCGTTATCTCAACGGC
AATATCACGCGCATGACCCTCTCCGGACGAGAAGCCGGCGGCAACCGTTACTATATCTACCGCGCCGTGC
TGCGCCCCACGCTGTGGTATCTGACGCAAAACCGCGATTTTCGCATCTACCAGGAACAGACCGTTCCCGA
CATCCTGACTCAGGTGCTGGGGCAGTATCAGGTGAAGATCGATAACCGCCTGAGTTACGACTACCGCATC
TGGGGGTACTGCGTGCAGTACCAGGAGAGCGATTTCGATTTCATCAGCCGCCTGATGGAACACGAAGGCA
TCTATTATTATTTCACGCACCAGCAAGACGGCCATACGCTGGTGCTGGCTGACGCGCCGGCGGCCCATCA
GGAACTCGCCGGCTACGCCAGCATTCCCTATCAGCTCGCGGAAGGCGGCCTGGTGGAAAACAAAGACAGC
ATCAACAGCTGGAGCGTTTCTGACGCCATCACGCCCAGCCTGTATAGCCTGGATGACTACGATTTTCGCA
AGCCGCGCGCGCGGTTGCTGGAGGCCCGGCAAAATCCCGCCTCATTCGCGCAGGACAAAGCAGAGGTGTT
CGACTGGCCCGGCCGTTATACCGATCACGCCCATGGCCAGTTTTACGTCAAGGTTCGCCAACAGGAGTTC
GAAGCGCAGCATGAGCAGATGAGCGGCGAAGGCAATTCGCAGGGCATTGCGCCCGGCTATCGTTTTCAAC
TGACCCAGGCGCCGCGTATGGAAGACAACCGCACCTACCTGGTGGTCAGCGCACATTACTTCATGCAGGA
GAACAGCTACACCAGCAACGATAACGATGTCGGCGAACAGCGAACCGAATTTCAGGTCGTTCCGGCGGAT
ATCAATTGGCGCCCGGCGCGCACCACGCCCTGGCCGAAAACCCATGGCCCGCAAACTGCCGAAGTGGTGG
GCCCGGAAGGCGAAAGCATCTGGACCGATAAATATGGCCGGGTGAAACTCAAATTCCGTTGGGATCGCCA
CGGCAGCGGCAACGAAACCAGCTCCTGCTGGGTGCGCGTCTCCAGCGCCTGGGCCGGCTGGAAATACGGC
GGGATCCAGATCCCGCGCGTCGGTGAGGAAGTGGTGGTCGACTTTATCAACGGCGATCCGGATCGCCCCA
TCATCACCGGCCGCGTTTACAACGAAGACAGCATGCCACCGTGGGATCTGCCCGGCGACGCCACCAAAAT
GGGCTTTATGAGCCGCAGCAAAGGCGGCGGCGTCGACAACGCCAGCTTCCTGTTCCTGGAAGACTCGCCC
GGCAACGAATCTTTCGACATGCACGCCGAACGCAACATGAACATGACGGTGGAGAACGACAAGAACGTCA
ATATTGACGGCAGTCGCACCACCACCATCGGTCGCCAGCAGGACGACACCGTCACCGGCGACGCCACGTT
CCTGTACAAAGCGAAACGCACCACAACGGTCAATGGGCTGGAAACCGCCAACCTGAACGCTCACCAGACG
GTGAACATCAAAGGCGGCCGCGACCTGACGATTATCGACGGTGGCGATAAAATCGACATCACCGGCAATC
AGTCCTTCAAGCTCGACGGCGCGCAGACGCAAAACATTACGCAAACCCAGCATGTCACGGTGAAAGGCAA
CCAGACCCTCGACATTACCGAGGGGCAACAAACCAGCACCATCAAGCAAGGGCAGACGGTCAACATCACC
TCCGGCGGGCAGCACACCACCATCACCGCCGGCGGGCAGGAATTGACGATTAAAGGCGGCGGCCAAACCG
CCACCGTAACCGGGGATGTCACCGAGACCTACAAAAACGATCAGAGCACCACGATCACCGGCACGCTGAC
CATCAAGGCGAAAACGATCAATATCACCAGCGCGGACGGCGTATCGGTGCAGACACCGAGCTGGAAAGAT
AACTGCCACGGCTTGAAATGGGTGGCGACCGGGGCCAACTTCGCCTTTTACGGTTCAAATCTTGCGTTGA
CAGGAGCCAGCCTGAAACACACGATGCTGGATATCTCGCACAACCCGCTGTCGATCAGCAAAACCAATTT
CAAGCTCAGTAATGATCCCATGACGTTCACGCAGCTTGGCGCGCTGGTGACCAACGGTGCCTTACGATTG
AGCACCAAGGCGCTGGCGATCTTCTTGTAA