SecReT6
Protein ID: 448242768
SecReT6 ID730
T6SS typei3
Gene symbolvasD
Locus tagSMWW4_v1c30080
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3244255..3244785 [+]
Producttype VI secretion system protein VasD
NoteTssJ
UniProt IDL7ZNV3
KEGG IDsmw:SMWW4_v1c30080
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.00E-32, Aligned region: 20..150
Protein Sequence: 176 a.a.     [Download]
>gi|448242768|ref|YP_007406821.1| type VI secretion system protein VasD [Serratia marcescens WW4]
MMTTPIASRWCGMLFLLLGALALGGCMSSAKSVPSRYSLVFDADRQVNAAAGAQPAPIKIRVLLLRSDAE
FMDADFFSLQNDAKSVLGNSLLDSDQFFLTPGQTGKTLGGQSALDARYIGVIAEYQNLDGKAWRISLPLP
EPTETNFYKVWQFSPDELEAHIVAGVNGLRPVKKVD
 
Nucleotide Sequence: 531 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3244255-3244785 Serratia marcescens WW4, complete genome
ATGATGACGACCCCTATCGCTTCCCGCTGGTGCGGGATGCTGTTTCTGCTGCTGGGCGCGTTGGCGCTCG
GCGGTTGCATGTCTTCCGCCAAAAGCGTGCCGTCGCGCTACAGCCTGGTGTTCGATGCCGATCGCCAGGT
CAACGCCGCCGCCGGCGCGCAACCGGCGCCGATAAAAATTCGCGTGCTGCTGCTGCGTTCGGATGCGGAA
TTCATGGATGCCGACTTCTTCAGTCTGCAAAACGACGCCAAAAGCGTGCTCGGCAATAGCCTGCTGGACA
GCGATCAGTTCTTCCTGACGCCGGGCCAGACCGGCAAGACGCTCGGCGGGCAAAGCGCATTGGACGCACG
TTACATCGGCGTGATCGCCGAGTATCAAAACCTGGACGGCAAGGCCTGGCGCATTTCGCTGCCGCTGCCG
GAGCCCACCGAAACCAATTTCTACAAGGTATGGCAATTCTCGCCGGATGAGCTGGAAGCGCATATCGTCG
CGGGCGTGAATGGCCTGCGCCCCGTAAAAAAGGTCGACTGA