SecReT6
Protein ID: 448242769
SecReT6 ID730
T6SS typei3
Gene symbolimpJ
Locus tagSMWW4_v1c30090
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3244826..3246172 [+]
Producttype VI secretion system protein ImpJ
NoteTssK
UniProt IDL7ZH00
KEGG IDsmw:SMWW4_v1c30090
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.40E-152, Aligned region: 19..443
Protein Sequence: 448 a.a.     [Download]
>gi|448242769|ref|YP_007406822.1| type VI secretion system protein ImpJ [Serratia marcescens WW4]
MKDAHKVVWTEGMFLRPHHFQQAENYLEGYMRNWGQAHSGCFWGFLTLDLDQTLLRQGKIALNAASGIMP
DGTPFRFAGAQQAPAPLSIAENKTGENVVLALPTYRAGREDVIFQESPEALARYLAYENEVDDLNAVSVG
SAALQFGRLRLRLMLESELNAEWTALGVTRVLEKRGDNSLRLDTAQIPPMLNCQGNPVLKTFINDLQGLL
QQRSQQMSQRLLQPGRGGSSEMVDFMLLQLINRHLGQVSHAYHLDHLHPERLFADWLQFATELASFSAQR
TPEGRLPVYDHDNLALCFGKLMLLLRQGLSVVLEDNAIQLTLVERSHGLNVATVQDTKMMRDFGFVLAVR
ADVAAEVLLTHFPAQMKIAPVTRIRDLVQLQLPGIGLRTMPVAPRQIPYHAGYTYFELEKGGDLWKQMEK
SSAFALHLAGEFPGLDMEFWAIRSHTDR
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3244826-3246172 Serratia marcescens WW4, complete genome
ATGAAAGATGCTCATAAGGTTGTCTGGACTGAGGGGATGTTTTTACGCCCTCACCATTTCCAGCAGGCGG
AAAACTATCTCGAAGGCTATATGCGCAACTGGGGCCAGGCCCACAGCGGCTGTTTCTGGGGGTTCCTGAC
CCTGGATCTGGACCAAACGCTGCTGCGCCAGGGCAAGATTGCGCTCAACGCCGCCAGCGGCATCATGCCG
GACGGCACGCCGTTTCGCTTTGCCGGTGCCCAGCAGGCGCCCGCGCCGCTGAGCATCGCCGAAAACAAGA
CCGGTGAAAACGTGGTGCTGGCCCTGCCGACTTACCGCGCAGGGCGTGAAGACGTGATCTTTCAGGAAAG
CCCGGAAGCGCTGGCGCGCTATCTGGCCTACGAGAACGAAGTCGACGATCTCAACGCCGTCTCGGTGGGC
AGCGCGGCGCTGCAGTTCGGCCGCCTGCGCCTGCGGCTGATGCTGGAGAGCGAGCTGAACGCCGAATGGA
CGGCGCTCGGCGTCACCCGCGTGCTGGAAAAGCGCGGCGACAACAGCCTGCGTCTCGATACGGCGCAAAT
CCCGCCGATGCTGAACTGTCAGGGCAACCCGGTACTGAAGACCTTCATCAACGATCTGCAGGGCCTGCTG
CAACAGCGCAGCCAGCAGATGAGTCAACGCCTGCTGCAGCCGGGCCGCGGCGGCAGTTCCGAAATGGTCG
ATTTCATGCTGCTGCAGCTGATCAACCGCCATCTCGGTCAGGTGAGCCATGCCTACCACCTCGACCATCT
GCACCCGGAGCGCCTGTTCGCCGATTGGCTGCAGTTCGCCACCGAACTCGCCAGCTTCTCGGCGCAGCGC
ACCCCGGAAGGCCGCCTGCCGGTGTACGACCACGACAACCTGGCGCTGTGCTTCGGTAAGCTGATGCTGT
TGCTGCGTCAAGGATTGTCAGTGGTGCTGGAAGACAACGCCATTCAGCTGACGCTGGTCGAACGATCCCA
CGGGTTGAACGTCGCCACCGTGCAGGACACCAAAATGATGCGCGACTTCGGTTTCGTCTTGGCAGTGCGC
GCCGACGTGGCCGCCGAGGTGTTGCTGACCCACTTCCCGGCGCAAATGAAGATCGCCCCGGTCACGCGCA
TCCGCGATCTGGTGCAGCTGCAGCTGCCGGGCATCGGTCTGCGCACCATGCCCGTCGCGCCGCGCCAGAT
CCCTTATCACGCCGGCTATACCTATTTCGAGCTGGAAAAAGGCGGCGACCTGTGGAAACAGATGGAAAAA
TCCAGCGCCTTCGCCCTGCACCTGGCCGGCGAATTCCCGGGGCTGGACATGGAATTTTGGGCGATTCGCA
GCCATACGGACCGGTAA