SecReT6
Protein ID: 448242770
SecReT6 ID730
T6SS typei3
Gene symbolimpK
Locus tagSMWW4_v1c30100
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3246194..3247396 [+]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDL7ZNL8
KEGG IDsmw:SMWW4_v1c30100
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.40E-70, Aligned region: 6..211
DUF2077 [PF09850], Evalue: 7.40E-70, Aligned region: 336..373
OmpA [PF00691], Evalue: 3.30E-16, Aligned region: 276..374
Protein Sequence: 400 a.a.     [Download]
>gi|448242770|ref|YP_007406823.1| type VI secretion system protein ImpK [Serratia marcescens WW4]
MAPGANPLVDAANPLLNAISQIRQSATHANPAQLRQQLIDEMRRFEIRGQRANLPYEVIIGARYCLCTAL
DEAAALTPWGSNSVWSGSGLLVTFHNETWGGEKFFQLLAKLSQSPREHINLLELINYCLLLGFEGRYRVM
ENGRSQLETMKQRLLQLIRTVRGGYAPPLSPHALDLPVQQKLWRPLVPLWACVALTGFLASLLFIALNWR
LGDNTSPVLAAIYQTNLPQVAIGNPAPAAPPTLSLKSFLRKEIAEGLVVVRDEAQQSVVILKGDGLFDSA
ATTVRANYIPVIDRIAAAMNGVSGKILVTGYSDNLPIRSARFASNWELSLARAEAVSARLQKHLANPQRV
KAEGRGESNPVAPNDNKVNRALNRRVEITLLVAPENTQAEINGLPQGTGK
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3246194-3247396 Serratia marcescens WW4, complete genome
ATGGCGCCGGGGGCCAATCCGCTGGTGGACGCCGCCAACCCGCTGCTGAACGCCATTTCGCAGATCCGCC
AGTCGGCCACGCACGCCAACCCGGCGCAGCTGCGCCAACAGCTGATCGACGAAATGCGCCGCTTCGAGAT
CCGCGGCCAACGCGCCAATCTGCCGTACGAAGTGATCATCGGCGCGCGTTATTGCCTGTGCACCGCGCTG
GATGAAGCGGCGGCGCTGACCCCGTGGGGCAGCAACAGCGTGTGGTCCGGCAGCGGGCTGCTGGTGACCT
TCCATAACGAAACCTGGGGCGGCGAAAAGTTTTTCCAGCTGCTGGCCAAGCTGTCGCAGAGTCCGCGTGA
GCACATCAACCTGCTGGAACTGATCAATTATTGCCTGCTGCTGGGCTTTGAAGGCCGCTATCGGGTGATG
GAAAACGGCCGTTCTCAGCTGGAAACCATGAAACAGCGCTTGCTGCAGCTGATCCGGACGGTGCGCGGCG
GCTACGCCCCTCCCCTGTCGCCTCATGCGTTGGATCTGCCGGTACAGCAAAAACTGTGGCGCCCGCTGGT
GCCGCTGTGGGCCTGCGTGGCGCTGACCGGCTTCCTGGCTTCGCTGCTGTTCATCGCCCTCAACTGGCGG
CTGGGCGACAACACCAGCCCGGTGCTGGCGGCGATTTACCAAACCAATCTGCCGCAGGTGGCGATCGGTA
ACCCGGCGCCGGCCGCGCCGCCGACGCTGAGCCTGAAAAGCTTCCTGCGCAAAGAGATCGCCGAAGGGCT
GGTGGTGGTGCGCGACGAAGCGCAGCAAAGCGTGGTGATCCTAAAAGGCGACGGGCTGTTCGACTCCGCC
GCCACCACGGTGCGCGCCAACTATATCCCGGTCATCGACCGCATCGCCGCCGCCATGAACGGCGTCAGCG
GCAAGATCCTGGTCACCGGCTACAGCGACAACCTGCCGATCCGCAGCGCCCGTTTCGCCTCCAACTGGGA
GCTGTCGCTGGCGCGCGCCGAAGCGGTCAGCGCCCGCTTGCAAAAACACCTCGCCAACCCGCAGCGGGTC
AAGGCCGAGGGCCGCGGCGAGAGCAACCCCGTCGCGCCGAACGATAACAAAGTGAACCGCGCGTTGAACC
GCCGGGTAGAAATTACGCTGTTGGTCGCCCCGGAAAACACCCAGGCGGAAATCAACGGCTTGCCGCAAGG
AACCGGAAAGTAA