SecReT6
Protein ID: 448242773
SecReT6 ID730
T6SS typei3
Gene symbolimpA
Locus tagSMWW4_v1c30130
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3251793..3252824 [+]
Producttype VI secretion system protein ImpA
NoteTssA
UniProt IDL7ZNV9
KEGG IDsmw:SMWW4_v1c30130
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.70E-22, Aligned region: 54..113
Protein Sequence: 343 a.a.     [Download]
>gi|448242773|ref|YP_007406826.1| type VI secretion system protein ImpA [Serratia marcescens WW4]
MAIDTDTLLAPVDADTPCGDNLEYDADFLAMARAATGKAEQQFGSTIIPEEAPDWVQVERLASSLLARTK
DLRVMLYLTRAWTQLRGLPGYADGLTLIHQAILRYWDALQPPLEFDGEADPLFRINALADLGDKAALAAS
VRAAPLLKSAAGEISLRDAGALLDGSKQECPNFPGGRARLQDELAQQDRPEGALVMHIANTLAAIRSEVT
RHLGESALPEMSALTKVFSLVALAGQSEAPAATEADATQETAAEQPPAAVQSASAPLNWRSAQIQSRDDA
QLMLDKVKNYFRLHEPSHPAPLMIDRVQRLITLDFMQIVRDLAPDGLNQLETILGRPDHEENS
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3251793-3252824 Serratia marcescens WW4, complete genome
ATGGCTATCGACACCGATACCCTGCTGGCCCCGGTTGACGCGGACACGCCCTGCGGCGACAACCTGGAAT
ACGACGCCGACTTTCTGGCCATGGCGCGCGCCGCCACCGGCAAAGCCGAACAGCAATTCGGCAGCACCAT
CATTCCGGAAGAAGCGCCGGATTGGGTGCAGGTCGAGCGCCTCGCAAGCTCGCTGCTGGCGCGCACCAAA
GACCTGCGCGTCATGCTGTATCTCACCCGCGCCTGGACCCAGCTGCGCGGATTGCCGGGCTATGCCGACG
GGCTGACGCTGATCCACCAGGCGATACTCCGCTACTGGGATGCCCTGCAGCCGCCGCTGGAGTTCGACGG
CGAGGCCGACCCGCTGTTTCGCATCAACGCGCTGGCCGACCTTGGCGACAAGGCCGCGCTGGCCGCCAGC
GTGCGCGCCGCGCCGCTGCTGAAAAGCGCCGCCGGTGAAATCTCGCTGCGCGATGCCGGCGCCCTGCTCG
ACGGCAGCAAGCAAGAGTGCCCCAACTTTCCCGGCGGCCGCGCACGGCTGCAGGATGAGCTGGCGCAACA
GGATCGCCCCGAAGGCGCGCTGGTGATGCACATCGCCAACACCCTGGCCGCCATACGCAGCGAAGTCACC
CGCCATCTGGGTGAAAGCGCGCTGCCGGAAATGAGCGCGCTGACCAAGGTCTTTTCGCTGGTGGCGCTCG
CCGGCCAGAGCGAGGCCCCGGCCGCCACCGAAGCGGACGCCACACAGGAAACCGCCGCTGAGCAGCCACC
GGCCGCCGTGCAGAGCGCCTCTGCCCCACTCAACTGGCGCAGCGCGCAGATCCAGTCGCGCGACGACGCT
CAGCTGATGCTGGACAAGGTGAAAAACTATTTTCGTCTTCATGAGCCAAGCCACCCGGCGCCGCTGATGA
TCGATCGGGTACAGCGACTGATTACGCTGGACTTTATGCAAATCGTCCGCGATTTGGCGCCCGATGGGCT
TAACCAACTGGAGACCATTCTCGGTCGCCCCGACCACGAGGAGAACAGCTAG