SecReT6
Protein ID: 448242774
SecReT6 ID730
T6SS typei3
Gene symbolimpB
Locus tagSMWW4_v1c30140
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3252947..3253483 [+]
Producttype VI secretion system protein ImpB
NoteTssB
UniProt IDL7ZH06
KEGG IDsmw:SMWW4_v1c30140
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.60E-60, Aligned region: 13..165
Protein Sequence: 178 a.a.     [Download]
>gi|448242774|ref|YP_007406827.1| type VI secretion system protein ImpB [Serratia marcescens WW4]
MSNSKSRSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKAVDPQASVEERKFMEIDVD
NFDERMKSLKPRVAYQVDNTLTGEGKLNIDLTFESMEDFSPAAIARKVDALDNLLDARTQLSNLLSYMDG
KNGAEELISKILQNPALLKSLTDAPKPAVNDDNNERED
 
Nucleotide Sequence: 537 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3252947-3253483 Serratia marcescens WW4, complete genome
ATGTCAAACTCGAAATCCCGCAGCGGGCAGAAATTCATCGCCCGCAACCGCGCGCCGCGCGTACAGATTG
AATACGATGTCGAAATTTATGGCGCAGAGCGCAAAATCCAGCTGCCGTTCGTGATGGGCGTGATGGCGGA
TCTGGTGGGGAAAGCGGTCGATCCGCAAGCCAGCGTGGAAGAGCGCAAGTTCATGGAAATCGACGTCGAC
AACTTCGACGAGCGCATGAAATCGCTGAAGCCGCGCGTCGCTTATCAGGTTGACAATACCCTGACCGGCG
AAGGCAAGCTGAACATCGATCTGACCTTCGAAAGCATGGAAGACTTCTCCCCCGCCGCTATCGCCCGCAA
GGTCGACGCGCTGGACAATCTGCTGGACGCCCGCACCCAGCTTTCCAACCTGCTGTCCTACATGGACGGT
AAAAACGGCGCCGAGGAGCTGATCTCCAAGATCCTGCAAAACCCGGCGCTGCTGAAATCCCTGACCGACG
CGCCGAAGCCGGCGGTTAACGATGACAACAACGAGCGTGAGGATTAA