SecReT6
Protein ID: 448242775
SecReT6 ID730
T6SS typei3
Gene symbolimpC
Locus tagSMWW4_v1c30150
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3253487..3254992 [+]
Producttype VI secretion system protein ImpC
NoteTssC
UniProt IDL7ZNM6
KEGG IDsmw:SMWW4_v1c30150
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-196, Aligned region: 67..493
Protein Sequence: 501 a.a.     [Download]
>gi|448242775|ref|YP_007406828.1| type VI secretion system protein ImpC [Serratia marcescens WW4]
MSNSPQQQNALQTTETFSSDEFSALLNKEFRPKTDQAKEAVENAVKTLAQQALENTVTVSSDAYRTIQAL
IAEIDEKLSQQINQIIHHDDFQKLEGAWHGLHYLVNNSETDEMLKIRFMSISKQELGRTLKRYKGVGWDQ
SPIFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMAKIGAASHCPFIAGTAPSVMQMESWQEL
SNPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLARLPYGIRTNPVDEFDFEEDTDGATHGNYTWT
NAAYAMAANINRSFKEFGWCTAIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHRKNSDFAAFIGAQSLQKPAEYYDADASANAQLSARLPYLFACCRFAHYLKCIVRDKIGSFRERDD
MERWLNDWIMNYVDGDPANSSQETKSRKPLAAAEVQVEEIEDNPGYYSAKFFLRPHYQLEGLTVSLRLVS
KLPSLKQNDAS
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3253487-3254992 Serratia marcescens WW4, complete genome
ATGAGCAACTCGCCTCAGCAACAGAATGCGTTGCAAACCACCGAGACTTTTTCCAGCGATGAGTTCAGCG
CGCTGTTGAACAAAGAGTTCCGGCCGAAGACCGATCAGGCCAAAGAAGCGGTCGAGAACGCGGTGAAAAC
GCTGGCGCAGCAGGCGCTGGAAAATACCGTCACCGTTTCTTCCGACGCCTACCGCACCATCCAGGCGCTG
ATCGCGGAAATCGACGAAAAGCTGTCGCAGCAGATCAACCAGATCATTCACCACGACGATTTCCAGAAGC
TGGAAGGCGCGTGGCACGGCCTGCACTACCTGGTTAACAACTCTGAAACCGACGAGATGCTGAAGATCCG
CTTCATGAGCATTTCCAAGCAGGAGCTGGGCCGCACGCTGAAGCGTTATAAAGGCGTGGGCTGGGATCAG
AGCCCGATCTTCAAGAAAATCTACGAAGAAGAGTATGGCCAGTTCGGCGGCGAGCCGTTCGGCTGCCTGG
TGGGCGACTACTACTTCGATCACAGCCCGCAGGACGTGGAGCTGCTGGGCGAAATGGCCAAGATCGGCGC
CGCCTCGCACTGCCCGTTCATCGCCGGCACCGCACCGAGCGTGATGCAGATGGAGTCCTGGCAGGAGCTC
TCCAACCCGCGCGATCTGACCAAGATTTTCCAGAACACCGAGTACGCCGCCTGGCGCAGCCTGCGCGAAT
CGGAAGACGCGCGCTACCTGGGCCTGGTGATGCCGCGCTTCCTGGCGCGCCTGCCGTATGGCATCCGCAC
CAACCCGGTGGACGAGTTTGACTTCGAAGAAGATACCGACGGCGCGACCCACGGCAACTACACCTGGACC
AACGCCGCCTACGCCATGGCCGCCAACATCAACCGTTCGTTCAAAGAGTTCGGCTGGTGCACCGCCATTC
GCGGGGTGGAATCCGGCGGCGCGGTGGAGAACCTGCCGTGCCACACCTTCCCGAGCGACGACGGCGGCGT
GGACATGAAGTGCCCGACCGAGATCGCCATCAGCGATCGTCGCGAAGCCGAGCTGGCCAAAAACGGCTTT
ATGCCGCTGGTGCACCGCAAAAACTCCGACTTCGCCGCCTTTATCGGCGCGCAGTCGCTGCAGAAGCCGG
CGGAATACTACGACGCCGACGCCTCTGCCAACGCCCAGCTTTCCGCGCGCCTGCCGTACCTGTTCGCCTG
CTGCCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAAATTGGCTCCTTCCGCGAGCGCGACGAC
ATGGAGCGCTGGCTGAACGACTGGATCATGAACTACGTGGACGGCGATCCGGCCAACTCCTCGCAGGAAA
CCAAGTCGCGCAAACCGCTGGCCGCGGCGGAAGTGCAGGTGGAAGAGATTGAAGACAACCCTGGCTACTA
CAGCGCCAAGTTCTTCCTGCGCCCGCACTACCAGCTGGAAGGCTTGACCGTTTCCCTGCGCCTGGTGTCG
AAGCTGCCTTCGCTGAAACAAAACGACGCGTCCTGA