SecReT6
Protein ID: 448242782
SecReT6 ID730
T6SS typei3
Gene symbol-
Locus tagSMWW4_v1c30220
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3259191..3260924 [+]
Producttype VI secretion system, FHA domain-containing protein
NoteFha
UniProt IDL7ZQ93
KEGG IDsmw:SMWW4_v1c30220
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-07, Aligned region: 27..93
UreE_N [PF02814], Evalue: 0.0092, Aligned region: 33..49
UreE_N [PF02814], Evalue: 0.0092, Aligned region: 78..99
Protein Sequence: 577 a.a.     [Download]
>gi|448242782|ref|YP_007406835.1| type VI secretion system, FHA domain-containing protein [Serratia marcescens WW4]
MRFSIVKNKSGQVPPQSSCDFLPPGGTIGRSVDNNLVLPDEERAISRLQAIVHISADGECRITNRGNVTR
VLLNDIPLERGRQVELQDGDVLGIDDYQIEVSALQQHAAPQAQPVAKVAAVAAAAAPAAAAKEKSAAPIP
NEIWDSLVEEFTPNAPAAVTPPPIANPDNHPLLDTPARELNPADPLAQLAGDVDLRQLQQQQTDPAALFN
TDSTFEREHILADTTPSALLAEQAAPPRPAPPVQNAQQPEQELDPLALFGGSSAPASPETLNSNDPLGLL
MGGAVPLAQPEEAVQPPSPPPAPIAAQPVAPRPQPTPPPVQRPEPQPQPAPQFSQQEPPAQPPRPRQGNR
LGIDPVAYQSAQRQHAAAPNGDTLEGPLLTALLQGVGLDDLQPQPHFDEQQIRLAGRLLSLFSQGTVALL
SSRSILKRGVKAEMTMILDEANNPFKLLPSGKTVLMQMFGSQMPGFMPPEQAVRDALIDLQAHQLGMIAG
IRAIIAAMLQSFNPERLEEEARKEGVAPRLSLPANRKAALWDYFVKNYQQTSGEIEDDFHTLFGEAFLHA
YDVEVNQYKDSQTKPDA
 
Nucleotide Sequence: 1734 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3259191-3260924 Serratia marcescens WW4, complete genome
ATGCGATTTTCCATTGTAAAAAATAAAAGCGGCCAGGTTCCGCCGCAGAGCAGTTGCGATTTTCTGCCGC
CGGGCGGCACCATCGGCCGCAGCGTGGACAACAACCTGGTGCTGCCGGACGAAGAGCGCGCCATTTCCCG
CCTGCAGGCGATCGTGCATATTTCCGCTGACGGCGAATGCCGCATCACCAACCGTGGCAACGTCACCCGC
GTGCTGCTGAACGACATTCCGCTGGAGCGCGGCCGCCAGGTTGAACTGCAGGACGGCGACGTGCTCGGCA
TCGACGATTACCAGATCGAAGTCAGCGCACTGCAGCAACACGCCGCGCCGCAGGCTCAACCGGTGGCCAA
GGTCGCCGCCGTTGCCGCTGCTGCGGCCCCTGCAGCCGCCGCCAAAGAAAAATCCGCCGCGCCGATCCCC
AACGAAATCTGGGACAGCCTGGTGGAAGAATTTACGCCGAACGCGCCGGCCGCCGTCACACCGCCGCCGA
TCGCCAATCCGGACAATCATCCGCTGCTGGATACCCCCGCTCGCGAGCTGAACCCGGCCGATCCGCTGGC
GCAGCTGGCGGGCGATGTCGATCTGCGCCAACTGCAGCAACAGCAAACCGATCCGGCCGCCTTATTCAAC
ACCGACTCCACTTTTGAGCGTGAGCATATCCTGGCCGATACCACCCCCAGCGCGCTGCTGGCGGAGCAGG
CTGCGCCGCCGCGCCCGGCTCCCCCCGTCCAGAATGCGCAGCAACCGGAACAAGAGCTGGATCCGCTGGC
GCTGTTCGGCGGCTCATCCGCGCCCGCTTCGCCAGAGACGCTGAACAGCAACGATCCGCTGGGGCTGCTG
ATGGGCGGCGCCGTGCCGCTGGCTCAGCCGGAGGAAGCGGTACAGCCGCCGTCCCCACCACCGGCGCCGA
TCGCCGCCCAGCCGGTAGCGCCGCGCCCTCAGCCGACGCCGCCGCCCGTGCAGAGACCCGAGCCGCAACC
CCAACCCGCGCCGCAGTTCAGCCAGCAGGAACCGCCTGCGCAGCCGCCGCGTCCGCGCCAGGGCAACCGC
CTGGGCATCGATCCGGTTGCCTACCAGTCCGCTCAGCGGCAGCACGCCGCCGCGCCGAATGGCGACACCT
TGGAGGGGCCGCTGCTGACGGCGCTGCTGCAAGGCGTCGGTCTTGACGATCTGCAGCCGCAGCCACATTT
CGACGAACAACAGATCCGCCTGGCCGGTCGCCTGCTGAGCCTGTTCTCGCAAGGCACCGTCGCCCTGCTC
TCATCCCGCTCGATCCTCAAGCGCGGCGTGAAGGCGGAGATGACCATGATCCTCGACGAGGCCAACAACC
CGTTCAAGCTGCTGCCTTCGGGCAAAACGGTGCTGATGCAGATGTTCGGCAGCCAGATGCCGGGCTTTAT
GCCGCCGGAACAGGCGGTGCGCGATGCGCTGATCGACCTGCAGGCGCACCAGCTGGGGATGATCGCCGGC
ATTCGCGCCATCATCGCCGCCATGCTGCAGTCGTTTAACCCGGAACGTCTCGAAGAAGAAGCGCGCAAGG
AAGGCGTGGCGCCGCGTCTGTCGCTGCCCGCCAACCGCAAGGCCGCGCTGTGGGACTACTTCGTGAAGAA
CTATCAGCAAACCTCCGGCGAAATCGAGGACGATTTCCACACCCTGTTCGGCGAAGCCTTCCTGCACGCC
TATGACGTTGAAGTGAATCAATACAAAGACTCACAGACCAAACCGGACGCGTAA