SecReT6
Protein ID: 448242785
SecReT6 ID730
T6SS typei3
Gene symbolcciE
Locus tagSMWW4_v1c30250
StrainSerratia marcescens WW4
Repliconchromosome [GenBank: NC_020211] [Browse all T6SS(s) in this replicon]
Location [Strand]3262728..3263549 [+]
Productvirulence protein SciE
NoteTagJ
UniProt IDL7ZNN7
KEGG IDsmw:SMWW4_v1c30250
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.20E-43, Aligned region: 29..70
ImpE [PF07024], Evalue: 7.20E-43, Aligned region: 149..269
Protein Sequence: 273 a.a.     [Download]
>gi|448242785|ref|YP_007406838.1| virulence protein SciE [Serratia marcescens WW4]
MKSLASMLRGQSIGAAITAVENDIKAKPADADLRAALVQLLCLSGNWTRANAQLKSWQALKPIAQPTTLL
LMQSVNAELQRQAVFAGTAAPALLRQDQPWLKLMVQALHQDAQGAAEQAQALRDEALEAAPAGAGRLTLA
EGEQERQLRFDWLTDGDGRLGPVCELALNGVYYWLPFADIAAIQFQAPQSAIDLVWSHALVRLTDGREQV
CQLPARYPLAEGSDDALLLGKRTEWQPLGDGTHYAGLGLKTWLSESDEFPLHSLRQLSFDASA
 
Nucleotide Sequence: 822 bp     [Download]
>gi|448239774|ref|NC_020211.1|:3262728-3263549 Serratia marcescens WW4, complete genome
GTGAAATCATTAGCAAGCATGCTGCGAGGCCAGTCGATCGGCGCGGCCATCACCGCCGTCGAAAACGATA
TCAAGGCGAAACCGGCGGATGCCGACCTGCGCGCCGCGCTGGTGCAACTGCTGTGTCTGAGCGGCAACTG
GACGCGCGCCAACGCGCAGCTGAAATCCTGGCAGGCGCTGAAACCGATCGCACAACCGACCACGCTGCTG
CTGATGCAGTCAGTCAACGCCGAGCTGCAACGCCAGGCGGTGTTTGCCGGCACGGCCGCGCCGGCGCTGC
TGCGGCAGGATCAGCCTTGGCTGAAACTGATGGTGCAGGCGCTGCATCAGGATGCGCAAGGGGCGGCCGA
ACAGGCCCAGGCGCTGCGTGATGAAGCGCTGGAGGCCGCTCCGGCCGGCGCCGGGCGGTTAACGCTGGCC
GAAGGCGAACAAGAACGGCAGCTGCGTTTCGACTGGCTGACCGACGGTGACGGCCGCCTCGGGCCGGTAT
GCGAACTGGCGCTGAACGGCGTTTACTACTGGCTGCCGTTTGCCGACATCGCCGCGATCCAGTTCCAGGC
GCCGCAGAGCGCCATCGACCTGGTGTGGAGCCATGCGCTGGTGCGCCTGACCGATGGCCGCGAACAGGTA
TGCCAACTGCCCGCCCGTTACCCGCTGGCAGAAGGCAGCGACGACGCGCTGCTGCTCGGCAAGCGCACCG
AATGGCAACCGCTGGGCGACGGCACCCACTATGCGGGGCTGGGCCTGAAAACCTGGCTCAGCGAAAGCGA
TGAATTCCCACTGCACAGCCTGCGGCAGTTGAGCTTCGACGCGAGCGCCTGA